KEGG   Comamonas testosteroni TK102: O987_08240
Entry
O987_08240        CDS       T03218                                 

Definition
(GenBank) 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase
  KO
K08690  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase [EC:1.3.1.56]
Organism
ctes  Comamonas testosteroni TK102
Pathway
ctes00621  Dioxin degradation
ctes01100  Metabolic pathways
ctes01120  Microbial metabolism in diverse environments
ctes01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ctes00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    O987_08240
Enzymes [BR:ctes01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.56  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase
     O987_08240
SSDB
Motif
Pfam: adh_short adh_short_C2 KR 3Beta_HSD Epimerase TrkA_N
Other DBs
NCBI-ProteinID: AIJ45794
UniProt: A0A076PGA1
Position
complement(1794998..1795828)
AA seq 276 aa
MQLTNEVALVTGGGSGLGRAIVDRFVAEGARVAVLDKSAARLQELKAAHGAKVLGIEGDV
RVLADHQKAARECVAAFGKIDCLIPNAGIWDYSMPLVDIPDDKIDAAFDEVFHINVKGYL
LAVKACLPALVQSRGSVVFTISNAGFYPNGGGPLYTATKHAVVGMVRELAFELAPHVRVN
GVAPGGMSTDLRGPASLGMANQAISSVPLGDMLASVLPVGRMPVAAEYTGAYVFFATRGD
TFPTTGALLNHDGGMGVRGFFDAAGGKDLPQKLQLS
NT seq 831 nt   +upstreamnt  +downstreamnt
atgcaactcaccaatgaagtagccctggtcaccggcggcggctcgggcctgggccgcgcc
atcgtggaccgcttcgtcgccgaaggcgcgcgcgtggccgtgctcgacaagtcggccgcc
aggctccaggagttgaaggccgcgcacggcgccaaggtgcttggcatcgaaggcgatgtg
cgcgtgctggccgaccaccagaaggccgcgcgcgaatgcgttgctgccttcggcaagatc
gactgcctgatccccaacgcgggcatctgggactattcgatgccactggtcgacatcccc
gacgacaagatcgatgccgccttcgacgaggtgttccacatcaacgtcaaaggctatctg
ctggccgtcaaggcctgcctgcccgcgctggtgcaaagccgcggcagcgtggtcttcacg
atctcgaacgccggcttctaccccaatggcggcggcccgctctacaccgccaccaaacat
gccgtcgtgggcatggtgcgcgaactcgctttcgaactggccccgcacgtgcgcgtcaac
ggtgtggcgcccggcggcatgagcaccgacctgcgtggcccggcctcgctgggcatggcc
aaccaggccatctccagcgtgccgctgggcgacatgctggcctcggtgctgccggtgggc
cgcatgcccgtggccgcggaatacaccggggcctatgtgttctttgccacgcgcggcgac
accttccccaccacgggcgctctgctgaaccatgacggtggcatgggcgtgcgcggcttt
ttcgatgctgctggcggcaaagacctgccgcagaaactgcagctttcataa

DBGET integrated database retrieval system