KEGG   Comamonas testosteroni TK102: O987_08245
Entry
O987_08245        CDS       T03218                                 

Definition
(GenBank) 3-phenylpropionate dioxygenase
  KO
K18087  biphenyl 2,3-dioxygenase ferredoxin component
Organism
ctes  Comamonas testosteroni TK102
Pathway
ctes00621  Dioxin degradation
ctes01100  Metabolic pathways
ctes01120  Microbial metabolism in diverse environments
ctes01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ctes00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    O987_08245
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: AIJ45795
UniProt: A0A076PQ38
Position
complement(1795847..1796179)
AA seq 110 aa
MMAFTKACSVDDVPPGEALQVSHDAQKVAIFNVEGEFFATQDQCTHGEWSLAEGGYLDGD
VVECSLHMGKFCVRTGKVKSPPPCEPLKVYPIRIEGQDVLVNFSAAALHT
NT seq 333 nt   +upstreamnt  +downstreamnt
atgatggcgtttaccaaagcctgcagcgtggacgatgttccgcccggagaagccttgcaa
gtcagtcatgacgcgcaaaaggtggcgattttcaatgtcgagggtgagttttttgccacg
caggatcagtgcacccacggagagtggtcgctggccgaaggtggttacctcgacggcgat
gtcgtggagtgctccctgcacatgggaaagttttgtgtgcgtacaggcaaggtcaaatcg
cccccgccctgcgagcctttgaaggtctatccgatccgcatagaagggcaggacgtgctg
gtcaatttttccgcagccgcgctgcatacctga

DBGET integrated database retrieval system