KEGG   Comamonas testosteroni TK102: O987_08475Help
Entry
O987_08475        CDS       T03218                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
ctes  Comamonas testosteroni TK102
Pathway
ctes00471  D-Glutamine and D-glutamate metabolism
ctes01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctes00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    O987_08475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ctes01011]
    O987_08475
Enzymes [BR:ctes01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     O987_08475
Peptidoglycan biosynthesis and degradation proteins [BR:ctes01011]
 Precursor biosynthesis
  Racemase
   O987_08475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Rossmann-like PFK
Motif
Other DBs
NCBI-ProteinID: AIJ45841
UniProt: A0A076PMD5
Position
complement(1833084..1833980)
Genome map
AA seq 298 aa AA seqDB search
MPTPHSPIGIFDSGVGGLSVLQALRHELPHEQFVYLADSGNAPYGDARGDAFVQERSLAI
AQYLLQQHDIKILVIACNTATAAAVELMRERMPQLPVIGVEPAIKPASFSSQTHHVGVMA
TRGTVSSQRVARLVAEHGQRAEFHLQACDGLARAIEQSTEQALPEDASATEIRALCTKYT
SALGSFGHKTGQMDTLVLGCTHYVFVKDDLRALLGPDIQFLDTGAPVARQTRRMLEQRHL
LGPETDGSRQLAQAEQIRLMTTGRLTAMQAAAQRWLDLPAACSQAVSVCSPSAVATPA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcccactcctcactcccccatcggcatttttgatagcggtgtgggtggcctcagcgtg
ctgcaggcactgcgccatgagctgccgcacgagcagttcgtctatctggccgacagcggc
aatgccccctatggcgacgcacggggcgatgcatttgtgcaggagcgcagcctggccatt
gcgcagtatctgctgcagcagcacgacatcaagattctggtgattgcctgcaataccgcg
acggctgcggccgtggagctgatgcgcgaacgcatgccgcaattgcccgtcatcggcgtg
gaacccgctatcaagccggcctctttttcgagccagacccatcatgtgggagtgatggcc
acccggggcactgtctccagccagcgcgtagcacgcctggtggccgagcatggtcagcgc
gccgagtttcatctgcaggcctgcgatggcctggccagagccatcgagcaaagcaccgag
caggcattgcccgaggatgcaagcgccaccgagatcagagcgctttgcacgaaatacacg
agcgctctaggcagtttcggccataagaccgggcagatggatacgctggtgctgggctgc
acccactatgtcttcgtcaaggacgatttgcgcgcgctgctggggccggatatccagttt
ctggacacaggcgcccctgtcgcgcgccagacccggcgcatgctggagcagcgccatctg
ctcgggcccgagaccgatggatcgcggcagctggcccaggccgagcagatccggctcatg
acaaccggccgcctgacggccatgcaagccgcggcccagcgctggctggatctgcctgcc
gcttgcagccaggctgtcagcgtgtgctcgccaagcgccgtggccacacccgcctga

DBGET integrated database retrieval system