KEGG   Comamonas testosteroni TK102: O987_13315Help
Entry
O987_13315        CDS       T03218                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ctes  Comamonas testosteroni TK102
Pathway
ctes00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ctes00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    O987_13315
Enzymes [BR:ctes01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     O987_13315
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     O987_13315
    1.1.1.-  
     O987_13315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Acetyltransf_7
Motif
Other DBs
NCBI-ProteinID: AIJ46781
UniProt: A0A076PPZ9
Position
2855771..2856871
Genome map
AA seq 366 aa AA seqDB search
MKALKWHGALDLRLEVIERRPLKAGEIRIEVAYCGICGSDMHEYLHGPDSIPVNVPHPLS
GRVAPIVIGHEFCGTVVEVAADVKGLGVGDRIAVEPEYRCGHCIYCRSGRYNLCESMGFV
GLMGDGGMAEEAVVPAYMAHVLPPSLSFRQAAVAEPAAVALHAVRRSALRAGDDCVIFGM
GAIGLLLVMIARHHEAGRIIAVDVDARRLGLARELGASDTVDASQGDVVQQVRELTGGVG
VPVSFEAVGRPETLQGALGVLSKGGEAVLLGLMPEARIDTFDLVNRELRITSSLGYRGLY
PELLELMARGVVDAGKIVTHAVSLEAAIQDGFERLASAGDAIKVLVQPQSLEVDRDAGSG
AHAGSS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctctgaaatggcatggcgctctcgatctgcgtctggaagtcatcgagcgcagg
cccttgaaggccggagaaatccgcatcgaggtagcgtactgcgggatctgcggcagtgac
atgcatgagtatctgcacgggccagactcgattccggtcaatgtcccgcatcccttgtcc
ggccgtgttgcgcccatcgtcatcggtcacgaattctgtggcacggtggtggaagtggca
gcagatgtgaaagggctcggcgttggcgacaggattgccgtggagccggagtaccgctgc
gggcactgcatctattgccgcagcgggcgctacaacctgtgcgaatccatgggctttgtg
gggctcatgggagatggtggcatggcagaggaagccgtggttcccgcctatatggcgcat
gtgctgcccccttcgctgagctttaggcaggctgcggtggccgagcctgctgcagtggca
ttgcatgctgtgcgccgaagcgcgttgcgcgctggcgacgattgcgtcatcttcggcatg
ggggccatcggtctgctgctggtgatgatagccaggcaccatgaagcgggccgcatcatt
gccgtcgacgtcgatgcacggcgcctgggtctggcgcgcgagctaggcgccagcgacacg
gtcgatgccagtcagggcgatgtggtgcagcaggtgcgtgaactcacgggcggggtgggc
gtaccagtctcgtttgaagcggtgggccgcccggaaacactgcagggtgctcttggagtg
ctgagcaagggcggcgaagccgtgctgctggggctcatgcccgaggcgcgtatcgatacc
ttcgatctggtcaaccgtgagctgcgcattacctccagcctgggctatcggggcctgtat
ccggaactgctggagctgatggctcgcggggtcgtggacgcaggcaagatcgtgacccac
gccgtaagtctggaagctgccatacaggacggttttgagcggctggcgtctgcaggggat
gcgatcaaggtgctggtgcagccgcagtcgctggaagtggaccgagatgccgggtccggc
gctcacgccggtagttcctga

DBGET integrated database retrieval system