KEGG   Comamonas testosteroni TK102: O987_26550Help
Entry
O987_26550        CDS       T03218                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
ctes  Comamonas testosteroni TK102
Brite
KEGG Orthology (KO) [BR:ctes00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    O987_26550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF11
Motif
Other DBs
NCBI-ProteinID: AIJ49377
UniProt: A0A076Q0Z3
Position
5642228..5642635
Genome map
AA seq 135 aa AA seqDB search
MPMNEFLVQVQPAYLPEQSAPAAGVYVFSYTITVTNTGEVPAQLIARHWIITNELGHVEE
VKGLGVVGRQPLLQPGESFEYSSGCQLRTPTGTMRGSYLCVNHEGETFECEIPLFVLQMN
ESGDPMPMPEKRVLH
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgaatgagtttctggtccaagtccagcccgcctacctgcccgagcaatccgcc
ccggccgccggcgtctatgtgttttcctacaccattaccgtcaccaacacgggtgaggtg
ccggcgcagctgattgcgcggcactggatcatcaccaacgagctgggccatgtcgaagag
gtcaaaggcctgggcgtggtgggccggcagccgttgctgcagcctggtgagtccttcgag
tacagcagcggctgccagctgcgtacgcccacgggcaccatgcggggaagctatctctgc
gtgaatcacgagggcgagaccttcgaatgcgagattccgctcttcgtattgcagatgaac
gagtccggcgaccccatgcccatgcccgagaagcgcgttctgcactga

DBGET integrated database retrieval system