KEGG   Clostridium tetani 12124569: BN906_00325Help
Entry
BN906_00325       CDS       T02905                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ctet  Clostridium tetani 12124569
Pathway
ctet00071  Fatty acid degradation
ctet00280  Valine, leucine and isoleucine degradation
ctet00310  Lysine degradation
ctet00362  Benzoate degradation
ctet00380  Tryptophan metabolism
ctet00620  Pyruvate metabolism
ctet00630  Glyoxylate and dicarboxylate metabolism
ctet00640  Propanoate metabolism
ctet00650  Butanoate metabolism
ctet00900  Terpenoid backbone biosynthesis
ctet01100  Metabolic pathways
ctet01110  Biosynthesis of secondary metabolites
ctet01120  Microbial metabolism in diverse environments
ctet01130  Biosynthesis of antibiotics
ctet01200  Carbon metabolism
ctet01212  Fatty acid metabolism
ctet02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ctet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN906_00325
   00630 Glyoxylate and dicarboxylate metabolism
    BN906_00325
   00640 Propanoate metabolism
    BN906_00325
   00650 Butanoate metabolism
    BN906_00325
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN906_00325
   00072 Synthesis and degradation of ketone bodies
    BN906_00325
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN906_00325
   00310 Lysine degradation
    BN906_00325
   00380 Tryptophan metabolism
    BN906_00325
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN906_00325
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN906_00325
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN906_00325
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ctet04147]
    BN906_00325
Enzymes [BR:ctet01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN906_00325
Exosome [BR:ctet04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN906_00325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C SpoVAD ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CDI48370
UniProt: U6EVZ1
Position
290912..292087
Genome map
AA seq 391 aa AA seqDB search
MKEVVIVSAVRTAMGKFGGTLKDVPAVELGATVIKEAINRAGIKPEIIDEVIMGNVIQAG
LGQSPGRQAAVKAGIPVEVPAFTLNKVCGSGLRAVGLAAQMIKAGDADVVIAGGMENMSA
APYVLPNARWGQRMFDGKMVDTMVKDGLWESFNDYHMGMTAENIAEKWELTREAQDEFAC
ASQNKTEKAIKEGKFKDEIVPVVIKTRKGEVVFDTDEFPRFGATVESLGKLKPAFKKDGT
VTAGNASGINDGAAALVIMSAEKAEELGLKPLAKIASYGSKGLDPAYMGYGPVGATKVAL
EKAGWKVEDLDLIEANEAFASQSLAVAKDLGFDMEKVNVNGGAIALGHPVGCSGARILVT
LLHEMQRRDSKKGLATLCIGGGMGTALLVER
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagttgttattgttagtgcagttagaactgccatgggtaaatttggaggaact
ttaaaagatgtacctgcagttgaattaggtgctacagttattaaagaagcaataaacaga
gcgggaattaaacctgaaattatagacgaagttataatgggaaatgttatccaagcagga
cttggacaaagtccaggaagacaagcagctgtaaaagctggaatacctgttgaagtacca
gcatttactttaaataaggtttgcggatcaggattgagagcagttggactagcagctcaa
atgataaaagctggagatgctgatgtagtaatagctggtggaatggaaaacatgtctgca
gcaccatatgttttaccaaacgctagatggggacaaagaatgttcgatggtaaaatggta
gatactatggtaaaagatggtttatgggaatcattcaatgattatcatatgggaatgaca
gcagaaaacatagcagaaaaatgggaattaacaagagaggcacaagatgagtttgcatgt
gcttcacaaaataaaactgaaaaagctattaaagaaggaaagtttaaagacgaaatcgtt
ccagtagttataaaaactagaaaaggtgaagtggtatttgatacagatgagttcccaaga
ttcggagctactgtagaatcattaggaaagttaaaaccagcatttaaaaaagacggaaca
gttacagcaggaaatgcatcaggtataaatgatggtgcagctgcgttagttataatgagt
gcagaaaaagctgaagaactaggattaaaaccattagctaagatagcttcctatggttca
aaaggattagacccagcttatatgggatatggaccagtaggtgcaacaaaagttgctctt
gaaaaagctggatggaaagtagaagacttagatttaatcgaagctaatgaagcttttgct
tcacaaagtttagctgttgctaaagatctaggatttgatatggaaaaagtaaatgttaat
ggtggagctatagcacttggacatccagtaggatgctctggagcaagaatattagttaca
ttactacatgaaatgcaaagaagagattctaaaaaaggtttagctactctttgcataggt
ggaggaatgggaacagctcttcttgtagaaagataa

DBGET integrated database retrieval system