KEGG   Clostridium tetani 12124569: BN906_01100Help
Entry
BN906_01100       CDS       T02905                                 

Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ctet  Clostridium tetani 12124569
Pathway
ctet00260  Glycine, serine and threonine metabolism
ctet01100  Metabolic pathways
ctet01110  Biosynthesis of secondary metabolites
ctet01120  Microbial metabolism in diverse environments
ctet01130  Biosynthesis of antibiotics
ctet01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctet00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN906_01100
Enzymes [BR:ctet01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BN906_01100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 DegT_DnrJ_EryC1 Pyridoxal_deC GSAP-16 OKR_DC_1 Aminotran_3
Motif
Other DBs
NCBI-ProteinID: CDI49108
Position
complement(1091945..1092970)
Genome map
AA seq 341 aa AA seqDB search
MDFLDLRSDTVTKPTENMRKAMFEAAVGDDVYGDDPTVNELEEYAAKLVGKEAALFVPSG
VFGNQLSLFTHCKRGDEVILGEDCHIIMHETGAPAVIAGVQLRPIKSENGFMSLDDIQSK
IRGENIHFPDTSLICVENAHSCGRVISLKHMEKIYNISRQHNIPIHLDGARLFNAVAYLD
VDVKDITKYCDSVMFSLSKGLCAPVGSILAGSKDFTEKARKKRKLMGGGLRQAGVLAAPG
LVALKEMIPQLKKDYENALLLGKELSKIPNIKVNLEDININMVFFSIENIDYDEVDIVNK
FYSKGIKINGTEDGKFRFATHYWIKEEDISYIVETMKTSLQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggattttttagatttgagaagtgataccgtaacaaaaccaacagaaaatatgagaaaa
gctatgtttgaagctgctgttggtgatgatgtatatggtgatgaccctacagtgaatgaa
ctagaagagtatgctgctaagttggtggggaaagaagcagccttatttgttccaagtgga
gtttttggtaatcaactgtccctttttactcattgcaaaagaggtgatgaggttatttta
ggagaggattgtcatataataatgcatgaaacaggagcacctgctgttatagctggtgta
caattaagacctataaaaagcgaaaatggattcatgtcattagatgatatacaaagtaaa
attagaggtgaaaatattcattttcctgatacttctcttatatgcgttgaaaatgctcat
tcctgtggaagagttatctctttgaaacatatggaaaaaatatataatatatcaaggcaa
cataatataccaatacatttagatggggctaggctatttaatgcagttgcatatttagat
gtagatgttaaagacataaccaaatactgtgattctgtaatgttttccctttctaaagga
ctttgtgctcctgttggatcaatacttgcaggtagcaaggactttacagaaaaagctaga
aagaaaagaaaactcatgggcggcggtttaagacaagcaggggtgttagcagcacctgga
ctggtagctttaaaggaaatgattcctcaattaaaaaaagactatgaaaatgcattatta
ttaggaaaagaattaagtaaaataccaaatataaaagtaaatttagaggatataaatatt
aatatggtattcttttctatagaaaatatagattatgatgaagtggatatagtaaataaa
ttttatagtaaaggtataaaaattaatggtaccgaagacggtaaatttagatttgccaca
cattattggattaaagaagaggatatttcatatatagtagaaaccatgaaaacttctctg
caataa

DBGET integrated database retrieval system