KEGG   Chlamydia trachomatis D-LC: CTDLC_0699Help
Entry
CTDLC_0699        CDS       T01901                                 

Gene name
psdD
Definition
(GenBank) Phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ctf  Chlamydia trachomatis D-LC
Pathway
ctf00564  Glycerophospholipid metabolism
ctf01100  Metabolic pathways
ctf01110  Biosynthesis of secondary metabolites
Module
ctf_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ctf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CTDLC_0699 (psdD)
Enzymes [BR:ctf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CTDLC_0699 (psdD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ADI52388
Position
802136..803041
Genome map
AA seq 301 aa AA seqDB search
MAAREMLYVNRETGKVEQERIICSSLVKFFIETRIGRALYSVLCKNSLFSRIVGWCQRLR
VTRYFIKPFVTKYRICIEESASPLHDYASFNDFFVRKLKPDARPICQGEDICVTPADGAY
LVFPSMADLSLFTIKNKPFSLESFLGDPQLAHQYAQGSMAIARLAPFDYHRFHFPIAGIA
EAPRRINGHLFSIHPLMLKRNFEVFTENKREITIITSKEFGEVAYVEVGALNVGSIHQTF
SPGSYVKKGAEKGFFAFGGSTVVLLFQPQRIIFDADLVGYSAQGLETRCRMGQSLGKRFS
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgcgggaaatgttatatgttaatcgcgaaacagggaaggtggaacaggaacgt
atcatctgttcttctctggtaaagttttttattgaaacgagaatagggagagctctgtac
tctgttttatgtaagaatagcctgttttcccgtatcgtaggctggtgtcaaagactgcga
gtgacgcgatattttattaaacctttcgttacaaaatatcgtatttgcatagaagagagt
gcttctcctctgcacgactacgcgtcatttaatgatttttttgtacgaaaactcaaacca
gatgctcgacctatctgccagggagaggatatctgtgtgactcctgctgatggtgcctat
cttgttttcccttccatggcagatctatccttgtttaccattaaaaataagccgttttct
ttagaaagttttttaggggatccgcaattggctcaccaatatgcgcaagggagtatggca
atcgctcgattagctccttttgattaccatcgcttccactttcctatagcgggtattgct
gaggcaccgcgccgtatcaacggccatcttttttctattcatcctcttatgcttaagcgg
aatttcgaagtgtttacggagaataaacgcgaaattaccataattacgtcaaaagagttt
ggtgaggttgcctacgtggaagtaggggcgttaaatgtgggttctatccaccaaacgttt
tctcccggtagttatgtgaaaaaaggtgccgaaaaaggtttttttgcttttggaggatcg
actgttgttctattatttcagccccaacggattatctttgatgcagatctagttggttat
tctgctcagggtttagaaacccggtgtcgaatgggacaatcgttaggaaaacgtttctct
tcataa

DBGET integrated database retrieval system