KEGG   Chlamydia trachomatis E/11023: E11023_03685Help
Entry
E11023_03685      CDS       T01902                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ctg  Chlamydia trachomatis E/11023
Pathway
ctg00564  Glycerophospholipid metabolism
ctg01100  Metabolic pathways
ctg01110  Biosynthesis of secondary metabolites
Module
ctg_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ctg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    E11023_03685
Enzymes [BR:ctg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     E11023_03685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ADH21185
Position
802603..803508
Genome map
AA seq 301 aa AA seqDB search
MAAREMLYVNRETGKVEQERIICSSLVKFFIETRIGRALYSVLCKNSLFSRIVGWCQRLR
VTRYFIKPFVTKYRICIEESASPLHDYASFNDFFVRKLKLDARPICQGEDICVTPADGAY
LVFPSMADLSLFTIKNKPFSLESFLGDPQLAHQYAQGSMAIARLAPFDYHRFHFPIAGIA
EAPRRINGHLFSIHPLMLKRNFEVFTENKREITIITSKEFGEVAYVEVGALNVGSIHQTF
SPGSYVKKGAEKGFFAFGGSTVVLLFQPQRIIFDADLVGYSAQGLETRCRMGQSLGKRFS
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgcgggaaatgttatatgttaatcgcgaaacagggaaggtggaacaggaacgt
atcatctgttcttctctggtaaagttttttattgaaacgagaatagggagagctctgtac
tctgttttatgtaagaatagcctgttttcccgtatcgtaggctggtgtcaaagactgcga
gtgacgcgatattttattaaacctttcgttacaaaatatcgtatttgcatagaagagagt
gcttctcctctgcacgactacgcgtcatttaatgatttttttgtacgaaaactcaaacta
gatgctcgacctatctgccagggagaggatatctgtgtgactcctgctgatggtgcctat
cttgttttcccttccatggcagatctatccttgtttaccattaaaaataagccgttttct
ttagaaagttttttaggggatccgcaattggctcaccaatatgcgcaagggagtatggca
atcgctcgattagctccttttgattaccatcgcttccactttcctatagcgggtattgct
gaggcaccgcgccgtatcaacggccatcttttttctattcatcctcttatgcttaagcgg
aatttcgaagtgtttacggagaataaacgcgaaattaccataattacgtcaaaagagttt
ggtgaggttgcctacgtggaagtaggggcgttaaatgtgggttctatccaccaaacgttt
tctcccggtagttatgtgaaaaaaggtgccgaaaaaggtttttttgcttttggaggatcg
actgttgttctattatttcagccccaacggattatctttgatgcagatctagttggttat
tctgctcagggtttagaaacccggtgtcgaatgggacaatcgttaggaaaacgtttctct
tcataa

DBGET integrated database retrieval system