KEGG   Chlamydia trachomatis E/11023: E11023_04370Help
Entry
E11023_04370      CDS       T01902                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ctg  Chlamydia trachomatis E/11023
Pathway
ctg00020  Citrate cycle (TCA cycle)
ctg00640  Propanoate metabolism
ctg01100  Metabolic pathways
ctg01110  Biosynthesis of secondary metabolites
ctg01120  Microbial metabolism in diverse environments
ctg01130  Biosynthesis of antibiotics
ctg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ctg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    E11023_04370 (sucC)
   00640 Propanoate metabolism
    E11023_04370 (sucC)
   00660 C5-Branched dibasic acid metabolism
    E11023_04370 (sucC)
Enzymes [BR:ctg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     E11023_04370 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: ADH21322
Position
965354..966514
Genome map
AA seq 386 aa AA seqDB search
MHLHEYQAKDLLTAYQLPIPPYHVATSVPEVETAIQAEQWKAGVVKAQVHAGGRGKNGGV
VIAHSPEDLLAAADKLLHMQFSSNQTAGLSLPINKVLISPLVEIASEYYLAIVIDRKHRC
PVIMLSKAGGVDIEEVAEKQPDQLLKMTLPSSGKIYGYQLRRIAKFMEWDQPIADQGNRI
IRQLLQCFYEKDASLLEINPLVLTKDGSLVILDAKMTIDDNALYRHPQLADCYDPSQENI
RDVLAKQLGLSYIALDGTIGCLVNGAGLAMSTLDILKLYGGSAANFLDVGGSASEKQIQE
AISLVLSDKSVRVLFIHIFGGIMDCAVVASGLVSAMQGQKETIPTVIRLEGTNVDKGKDM
IINAGIPCEFVTSMSEGAELAVQLSR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttcatgagtatcaagctaaggaccttttaactgcttatcaacttcctattccc
ccctatcacgtagcgacctccgtacctgaagtagaaacagcgattcaagccgaacaatgg
aaagctggtgttgtgaaagcacaggttcatgctggaggaagaggaaaaaatggaggggtg
gttattgcgcactctccggaagacttattagcagcagctgataagctactgcatatgcaa
ttttctagtaatcagacagcagggttgtctcttcctattaataaagtattgatttcccct
ttagtagagattgcttcggagtattatcttgcgatcgtcatcgatagaaaacatcgttgt
cctgtcattatgctatctaaagcaggaggtgtggatatcgaggaagtcgcagaaaagcag
ccggatcagctgcttaaaatgacactaccttcttctggaaaaatttatgggtatcagtta
cgccgtattgctaagttcatggagtgggatcaacctattgccgatcaagggaatcgtatc
attcgccagttattacaatgtttttatgaaaaggatgcttctttattagagattaatcca
ttggtacttactaaagacgggtctcttgtcattctagatgccaaaatgacgattgatgac
aatgctctttatcgacatcctcagctagcagactgctatgatccttctcaggaaaatatt
cgtgacgtactagctaagcagttaggcctttcatacattgctctagatggaacaatcgga
tgtttagtcaatggtgcaggattagcgatgagcaccttagatattctgaagttatatggc
ggttctgctgccaatttcttagatgtaggaggaagtgcttctgaaaagcaaattcaagaa
gccatctctttagtcttatctgataaaagtgtgcgcgtgctctttatccatatttttggg
gggattatggattgtgcagtcgtcgcttctggacttgtttctgctatgcaaggacagaaa
gaaacgatccctactgtaattcggttagaagggacgaatgtagataaaggaaaggacatg
attattaacgcaggaattccttgtgagttcgttacatccatgagcgagggggctgaactc
gctgtgcaattaagtcgttag

DBGET integrated database retrieval system