KEGG   Hungateiclostridium thermocellum ATCC 27405: Cthe_0505
Entry
Cthe_0505         CDS       T00474                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
cth  Hungateiclostridium thermocellum ATCC 27405
Pathway
cth00620  Pyruvate metabolism
cth00640  Propanoate metabolism
cth00650  Butanoate metabolism
cth01100  Metabolic pathways
cth01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cthe_0505
   00640 Propanoate metabolism
    Cthe_0505
   00650 Butanoate metabolism
    Cthe_0505
Enzymes [BR:cth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Cthe_0505
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ABN51742
UniProt: A3DCR3
Position
616237..618465
AA seq 742 aa
MDAWRGFNKGNWCQEIDVRDFIIRNYTPYEGDESFLVGPTDRTRKLWEKVSELLKKEREN
GGVLDVDTHTISTITSHKPGYIDKELEVIVGLQTDEPLKRAIMPFGGIRMVIKGAEAYGH
SVDPQVVEIFTKYRKTHNQGVYDVYTPEMRKAKKAGIITGLPDAYGRGRIIGDYRRVALY
GVDRLIAEKEKEMASLERDYIDYETVRDREEISEQIKSLKQLKEMALSYGFDISCPAKDA
REAFQWLYFAYLAAVKEQNGAAMSIGRISTFLDIYIERDLKEGKLTEELAQELVDQLVIK
LRIVRFLRTPEYEKLFSGDPTWVTESIGGMALDGRTLVTKSSFRFLHTLFNLGHAPEPNL
TVLWSVNLPEGFKKYCAKVSIHSSSIQYESDDIMRKHWGDDYGIACCVSAMRIGKQMQFF
GARCNLAKALLYAINGGKDEMTGEQIAPMFAPVETEYLDYEDVMKRFDMVLDWVARLYMN
TLNIIHYMHDKYAYEALQMALHDKDVFRTMACGIAGLSVVADSLSAIKYAKVKPIRNENN
LVVDYEVEGDYPKFGNNDERVDEIAVQVVKMFMNKLRKQRAYRSATPTLSILTITSNVVY
GKKTGNTPDGRKAGEPLAPGANPMHGRDINGALAVLNSIAKLPYEYAQDGISYTFSIIPK
ALGRDEETRINNLKSMLDGYFKQGGHHINVNVFEKETLLDAMEHPEKYPQLTIRVSGYAV
NFIKLTREQQLDVINRTIHGKI
NT seq 2229 nt   +upstreamnt  +downstreamnt
atggatgcatggcgcggatttaataaaggcaactggtgccaggaaattgacgttcgtgat
tttataattagaaattatactccttatgaaggcgatgaaagctttcttgtaggacctacg
gatagaacgcggaaactttgggagaaggtttccgaactgttaaagaaagaacgggagaac
ggcggggtattggatgttgatacccatacaatttcaacgattacgtctcataaacctgga
tatatagataaagaacttgaagttattgtcgggcttcagacggatgagcctttaaaaaga
gccataatgccgtttggcggtatacgtatggtgattaagggagccgaagcttatggccac
agtgtggaccctcaggttgttgaaatattcacaaagtacagaaagactcataaccaggga
gtttatgatgtatatactcccgaaatgagaaaagccaaaaaagccgggattattacagga
cttcccgacgcatacggcagaggaagaataattggcgattacagaagggttgcactttat
ggcgttgacaggctgattgctgaaaaagagaaagaaatggcaagtcttgaaagagattac
attgactatgagactgttcgagacagagaagaaataagcgagcagattaaatctttaaaa
caacttaaagaaatggctttaagttacggttttgacatatcttgtcctgcaaaggatgcc
agagaagcctttcaatggttgtattttgcatatcttgcagcagtcaaggaacagaacggc
gcggcaatgagtattggaagaatttcgactttccttgacatatacattgaaagggatctc
aaagaaggaaaactcacggaggagttggctcaggaactggttgaccagctggttataaag
ctgagaattgtgagatttttgagaactcctgagtatgaaaagctcttcagcggagacccc
acttgggtaaccgaaagtatcggaggtatggcgctggatggaagaacgctggttacaaaa
tcttcgttcaggtttttgcacactcttttcaacctgggacatgcaccggagcccaacctt
acagtactttggtccgtcaatcttcccgaaggctttaaaaagtactgtgcaaaggtatca
attcattcaagctccatccagtatgaaagcgacgacataatgaggaaacactggggagac
gattatggaatagcatgctgtgtttctgctatgagaattggaaaacagatgcagttcttc
ggtgcaagatgcaatcttgcaaaagctcttctttacgctattaacggcggaaaggatgaa
atgacgggagaacagattgctccgatgtttgcaccggtggaaaccgaataccttgattac
gaggacgtaatgaagaggtttgacatggtgcttgactgggtggcaaggctttatatgaac
accctcaatataattcactacatgcatgacaaatatgcctatgaggcgctgcagatggca
ttgcatgacaaagacgtgttcaggacgatggcatgcggaatagccggtttgtctgtggtg
gcagactcccttagcgcgataaaatatgcaaaggttaaaccgatacgcaatgaaaacaac
ctcgttgttgactacgaagttgagggtgattatcctaaattcggaaataacgacgaacgt
gttgatgaaattgcagtgcaagtagtaaaaatgttcatgaacaagcttagaaagcaaagg
gcttacagaagtgccactccgaccctttccatacttaccataacttcaaacgtggtatat
ggaaagaaaaccggaaacactcctgacggcagaaaagctggagaacctttggcgccggga
gcaaatccgatgcatggaagggatataaacggagcattggctgtactgaacagtattgcg
aagcttccctatgaatatgcccaggacggcatttcatatactttctccataattccaaaa
gctctgggaagagacgaggaaaccagaataaacaatcttaaatcaatgcttgacggatat
ttcaagcagggcggccaccacataaatgtaaatgtgtttgaaaaagagacactgttagat
gccatggaacatccggaaaaatatccacaacttaccataagagtgtccgggtatgcagtg
aactttataaagcttacacgggagcaacagctggatgttattaacagaacgattcacgga
aagatttaa

DBGET integrated database retrieval system