KEGG   Hungateiclostridium thermocellum ATCC 27405: Cthe_1782
Entry
Cthe_1782         CDS       T00474                                 
Name
(GenBank) ribosomal protein S9
  KO
K02996  small subunit ribosomal protein S9
Organism
cth  Hungateiclostridium thermocellum ATCC 27405
Pathway
cth03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cth00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Cthe_1782
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cth03011]
    Cthe_1782
Ribosome [BR:cth03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Cthe_1782
  Bacteria
    Cthe_1782
  Archaea
    Cthe_1782
SSDB
Motif
Pfam: Ribosomal_S9
Other DBs
NCBI-ProteinID: ABN53003
UniProt: A3DGC4
Position
complement(2103580..2103972)
AA seq 130 aa
MAKVQYYGTGRRKKSVARVRLVPGDGKIIINERELDDYFGLETLKTIVKQPLVLTDTLGK
FDVLCKVAGGGYTGQAGAIRHGISRALLKFDEELRPALKKAGFLTRDPRMKERKKYGLKK
ARRAPQFSKR
NT seq 393 nt   +upstreamnt  +downstreamnt
atggctaaggtacaatattacggtacaggaagaagaaagaaatccgttgcgagagttaga
cttgttccgggagacggaaaaattatcataaatgagagagaacttgacgattatttcgga
cttgaaacattaaaaaccattgttaagcagcctttggtgctgactgatacattaggcaag
tttgacgtgctctgcaaagtggcaggaggcggttatacaggtcaggccggcgctatcaga
catggtatttcaagggcgcttttaaagtttgatgaagagttgagacctgcgcttaaaaaa
gccggattcctcacaagagacccgagaatgaaggaaagaaagaaatacggtctcaagaaa
gcaagaagagcacctcagttctccaagaggtaa

DBGET integrated database retrieval system