KEGG   Hungateiclostridium thermocellum ATCC 27405: Cthe_1849
Entry
Cthe_1849         CDS       T00474                                 
Name
(GenBank) Heavy metal transport/detoxification protein
Organism
cth  Hungateiclostridium thermocellum ATCC 27405
SSDB
Motif
Pfam: DsbD_2 HMA Spore_YhcN_YlaJ Cupredoxin_1 HMA_2
Other DBs
NCBI-ProteinID: ABN53070
UniProt: A3DGJ1
Position
complement(2194563..2196062)
AA seq 499 aa
MKNNFTANKLYVQGMTCTGCETRIENVLRKLDGVTDVKASYTSSTVYVAYDKSKLNLDKI
IETVEKLDYKIKGVEDEKNAGYDKRENFAPENGSKTETGQLLGIIIVFLAFLLIIKNGRV
FNFIPEIDRSMSYGLLFVAGLLTSLHCVAMCGGINMSVCMQYKSAGGKSKALGSSDGKTG
KAVEFEQLMPSFLYNLGRVISYTVVGGVVGALGSVISFSGAAKGVVAIISGVFMVIMGLN
MLNIFPVLRKITPRMPKIFGRKISNAKNKGPLLVGLLNGFMPCGPLQAMQLYALGTGSFI
AGATSMFMFSLGTVPLMFGLGAISSIAGGKFTQKMMRISAVLVIVLGVVMFNRGLSLSGY
SFPIFYADSAKGASIARIEGDVQVVETQLEPGRYAPIVVQKGIPVKWTIKANKEDLNGCN
NAIVAREFGIDNRKLEVGDNIIEFTPAREGEFVYSCWMGMIHGYIKVVNDINEIDQDDIN
LKNEGFNLNKILPKGCCGI
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgaaaaataattttacggcaaataagctttatgtgcagggaatgacgtgcacagggtgt
gagacgagaatagagaatgtattaagaaaattggacggcgtaaccgatgtcaaggcttca
tacacaagctcgaccgtttacgtggcctatgacaaaagcaaattaaacctggataaaata
attgagaccgtggaaaagcttgattataaaataaaaggcgttgaagatgaaaaaaatgca
ggctatgataaaagagagaattttgcgccggagaatgggagtaaaacggaaacagggcag
cttttgggcattatcattgtatttctggctttcctgctcattataaagaacggccgggta
tttaatttcataccggaaatagaccggtcgatgagttatggattgctttttgtggcgggt
cttttaacttcgcttcactgtgttgccatgtgcggcggaattaacatgtccgtgtgcatg
caatacaaaagtgccggcggcaaatccaaagcgctgggaagttcagacggtaagacagga
aaagcggttgaatttgaacagcttatgccaagttttttgtacaacctgggcagagtaatt
tcctataccgttgtaggcggggttgtgggggcactcggctctgtgattagtttttcaggt
gccgccaaaggtgtggtggcaattatatccggtgtttttatggttatcatgggattgaat
atgctcaatatttttccggttttaagaaagattactcccagaatgcccaaaatttttggc
aggaagataagcaatgccaaaaacaaagggccgctgcttgtgggacttctaaacggtttc
atgccgtgcggtcctcttcaggcaatgcagctttatgccttgggcacgggtagttttatt
gccggtgctacgtcgatgtttatgttttccctggggacggttcctcttatgtttggcctt
ggggcaataagctccatagccggcggaaaatttacgcaaaagatgatgaggataagtgcc
gttttggtgattgttttgggagttgtcatgtttaacaggggtctgagtctttcgggatac
agttttcctattttctatgccgactccgcgaagggtgcaagtattgccagaatcgaaggg
gatgttcaggttgttgaaacacagctggagcctggaagatatgcaccgatagtcgttcaa
aagggtataccggtaaagtggacgataaaagccaacaaagaagacttgaacggctgcaac
aacgcaattgttgcccgggagtttggaatagacaataggaaactggaagttggagataat
ataattgaatttacgccggcaagagaaggagaatttgtttattcttgttggatgggaatg
attcatgggtatataaaagttgtaaatgacattaacgagatagatcaggatgacataaac
ttaaaaaacgaaggttttaatttgaataaaatacttccgaaaggttgctgcggcatctag

DBGET integrated database retrieval system