KEGG   Hungateiclostridium thermocellum ATCC 27405: Cthe_2096Help
Entry
Cthe_2096         CDS       T00474                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cth  Hungateiclostridium thermocellum ATCC 27405
Pathway
cth00450  Selenocompound metabolism
cth00970  Aminoacyl-tRNA biosynthesis
cth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cth00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Cthe_2096
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cthe_2096
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cth01007]
    Cthe_2096
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cth03016]
    Cthe_2096
Enzymes [BR:cth01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Cthe_2096
Amino acid related enzymes [BR:cth01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Cthe_2096
Transfer RNA biogenesis [BR:cth03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Cthe_2096
 Prokaryotic type
   Other AARSs
    Cthe_2096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f ATG11
Motif
Other DBs
NCBI-ProteinID: ABN53303
UniProt: A3DH74
Position
complement(2491872..2493836)
Genome map
AA seq 654 aa AA seqDB search
MDRKTFYITTPIYYPSDKLHIGHSYTTVAADAVARYKRLKGYDVMFLTGTDEHGQKIERK
AKEKGVTPKQYVDEIVAGIKELWKLLKITNDRFIRTTDPHHEKTVQKIFKKLYDQGDIYK
SEYEGWYCTPCESFWTKTQLVDGKCPDCGREVELTKEESYFFRLSKYQDRLIKHIEENPD
FIQPVSRQNEMLNNFLRPGLEDLCVSRTTFDWGIPVSFDDKHVVYVWIDALSNYITALNY
MSEDDSDYRKYWPADVHLVGKEIVRFHTIIWPAMLMALGEPLPKQVFGHGWLLLEGGKMS
KSKGNVVDPVVLVEKYGVDAIRYFLLREVPFGSDGVFSNEALINRINSDLANDLGNLVSR
TVAMIDKYFGGKLPQERQAGEFDDDLIKTVTDTPQKVEELLDRLQFSTALTEIWKAISRT
NKYIDETMPWALAKSEENKARLAAVLYNLAESIRIVSILIQPFMPETPEKIWHQLGINDK
KYVEWETAKKWGVYPEGAAVNKGEPLFPRIDVKKELEELEKLTLAAAENKEKQSPKQETE
KKDAEKNEYITIEDFEKLDLRVGKVLEAQKVENADKLLKLKIEVGNEVRQVVSGIAKYYS
PEELKGKYVVLVANLKPVKLRGIESQGMILAASDDKDLVLVTIDKEINSGTKVQ
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggatagaaagactttttacattacaacgcccatttattacccgagcgacaagttacat
ataggccactcatacactactgttgcggcggatgccgtggcaagatacaaaaggctgaaa
ggttacgatgtaatgtttcttacgggaacggatgagcatggacagaagattgaacgcaag
gcgaaggaaaagggagttaccccgaaacagtatgtggatgaaattgtggccggaatcaag
gaactgtggaagcttttgaaaataaccaacgacaggtttatcagaacgacggatccccac
catgagaagactgtgcagaagatatttaaaaagctctacgaccagggagatatttacaag
agtgaatatgaaggctggtattgcactccttgtgagtctttctggacgaagacacagctg
gttgacggaaaatgtcccgactgcggaagggaagtggaacttacaaaagaggagagctat
ttcttcaggctttccaaatatcaggaccggctgataaaacatatcgaggagaatccggat
tttatacagcctgtttccagacagaacgagatgctgaacaatttcttaaggccggggctt
gaagacctttgcgtgtccagaaccacctttgactggggaataccggtgtcctttgatgac
aagcacgtggtatatgtttggattgacgccctttccaactatattaccgcccttaactac
atgtccgaggacgattcggattaccgcaagtactggcctgcggatgttcatcttgtggga
aaggaaatagtgcgtttccacaccatcatatggcctgcaatgctcatggctttgggtgag
cctttgccgaagcaggtatttggccatggctggctccttcttgagggcggaaaaatgtcc
aagtccaagggaaatgtggtcgatcctgttgtgcttgttgaaaagtacggtgttgacgcg
ataaggtatttcctcttaagagaggttcctttcggttcggacggagtattttcaaatgaa
gcattgataaacaggattaattcagacttggcaaacgaccttggaaatcttgtcagcagg
accgttgccatgattgacaaatattttggagggaagctgccgcaggaaagacaggcggga
gaatttgacgacgaccttataaagactgtgacggatacacctcaaaaggttgaggaactg
cttgaccgtttgcagttcagtacggcgcttactgaaatctggaaagccatttccagaacc
aacaagtatattgacgagacaatgccgtgggcactggcaaaaagtgaagaaaacaaggca
agacttgccgctgttttatacaatcttgcggaaagtatcagaatagtttccatactcata
cagccgtttatgcctgaaactcctgaaaagatatggcatcagctgggtataaacgacaaa
aagtatgtggagtgggaaactgcaaagaaatggggagtatatcctgaaggtgccgctgtg
aacaaaggagaacccttgttcccgagaattgatgttaagaaagagctggaggaattggaa
aagctcactttggctgcggctgaaaataaggaaaagcaatcaccgaagcaggaaacggag
aaaaaggatgcggaaaagaatgaatatatcaccatagaggattttgagaagctggatttg
agggttggcaaggttcttgaggctcagaaggttgaaaatgccgacaagttgctgaaacta
aagattgaagttggcaatgaagtacgccaggtggtgtccggtattgcaaagtactactct
ccggaggaattaaagggtaaatacgttgtgctggtggcaaacttaaagccggtaaaactc
aggggaatagagtcgcagggtatgattcttgccgcttcggatgacaaggacctggtactg
gtgacgattgacaaagagataaacagcggaaccaaggttcagtaa

DBGET integrated database retrieval system