KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_2529Help
Entry
Cthe_2529         CDS       T00474                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
cth00860  Porphyrin and chlorophyll metabolism
cth01100  Metabolic pathways
cth01110  Biosynthesis of secondary metabolites
cth01120  Microbial metabolism in diverse environments
Module
cth_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cthe_2529
Enzymes [BR:cth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Cthe_2529
Exosome [BR:cth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cthe_2529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABN53731
UniProt: A3DIF2
Position
2997875..2998855
Genome map
AA seq 326 aa AA seqDB search
MLIRPRRLRLNQHIRDMAREVRLSSKSLILPLFLMEGKNVKLPVNSLEGHFYYSPDTVFE
AVDDALKCGVNKFLLFGLPSEKDEIGSQSFNENGVIQKAVRAIKERYRDEVLVITDVCMC
EYTSHGHCGILNHGYVDNDKTLEYLAKIALSHAAAGADMVAPSDMMDGRVAAIRQELDKH
NFINTLIMSYAVKYSSSFYGPFRDAAKSAPSFGDRKSYQMDYHNKKEAVKEALTDINEGA
DILMVKPALAYLDVISEVSKHSSLPTAAYSVSGEYAMIKAAAKMNLIDEYPTMCETAVSI
FRAGADILISYYAKEIAEAINRGDIG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgctaatcaggccacgcagattgcggctcaatcaacatataagagatatggcaagagaa
gtaaggctaagcagtaagtcgctcatattgccgcttttccttatggagggcaaaaatgta
aagctgcctgtaaactctcttgaaggccatttttattacagcccggatacagtttttgaa
gcagtggacgatgctctaaaatgcggagtaaacaagtttttgctttttgggttgccgtca
gaaaaggatgagatcggaagccagagttttaacgaaaacggagtcatacaaaaagcagtc
cgggcaattaaggagcgctacagggatgaagtgcttgtcataaccgatgtctgcatgtgt
gaatatacttcccacggacattgcggaatattgaaccatggatatgttgacaatgacaaa
actctggagtatctcgccaaaattgccctgtcccatgcagcggccggggcggacatggtg
gcaccgtcggatatgatggacggcagggtggcggcaatccggcaagagttggacaaacac
aactttatcaatacgcttatcatgtcatatgccgtaaaatattcgtcatctttttacgga
ccgttccgtgatgctgcaaagtccgccccgtcctttggggaccggaagtcataccaaatg
gactatcacaacaaaaaagaggctgtaaaggaagccttgacggatataaacgaaggtgcg
gatattctaatggtaaaaccggcattggcttatttggacgttatcagcgaagtttccaaa
cactccagcctgcccacggcggcatacagtgtcagcggagagtatgcaatgataaaagca
gctgcgaaaatgaatctgatagatgaatacccaacgatgtgcgaaactgcagtatctatc
tttagagccggagcggatattttaatctcatactacgccaaagagatagcagaagcaatt
aacaggggggacataggataa

DBGET integrated database retrieval system