KEGG   Hungateiclostridium thermocellum ATCC 27405: Cthe_3000Help
Entry
Cthe_3000         CDS       T00474                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cth  Hungateiclostridium thermocellum ATCC 27405
Brite
KEGG Orthology (KO) [BR:cth00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Cthe_3000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABN54196
UniProt: A3DJR7
Position
3522402..3523454
Genome map
AA seq 350 aa AA seqDB search
MTVSLTDFLSHLISSPPLIITTLLTLGVIMVNGWTDAPNAIATCVSTRSISPRAAIVMAA
FFDFLGVFVMTKINARVAETIYKMVDFGGDPNKALVALCAALFAIVLWATAAWWFGIPTS
ESHALIAGISGAAIALQKGLHGINFNEWVNVLYGLALSLVLGFATGWTVVKLVEKIFRRV
NRAKTFGFFKNAQVLASAGMAFMHGAQDGQKFMGVFMLGVFLTQGQAQVTEFIIPNWMLI
LCSAVMATGTSIGGYRIIKAVGMDMVKLEKYQGFSADLAGVICLLTASVFGLPVSTTHTK
TTAIMGVGAAKRISSVNWGVVKEMVSAWVLTFPGCGLIGFLMALLFMNIF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgactgtatcacttactgattttttaagtcatttgatatcgagtcctccattaattata
actactcttcttacactgggagttataatggttaatggatggacggatgctcctaacgcg
attgccacttgtgtttccacacggtcgataagtccgcgtgcggctatagtgatggcagcg
ttttttgactttcttggtgtttttgttatgaccaagatcaatgcgagggtggcagagacc
atttataaaatggttgatttcggaggagaccctaacaaagccctggtagccctttgcgct
gctctttttgcaattgtgctttgggcgacggccgcatggtggtttggaattccaaccagt
gaaagccatgcacttattgccggaataagcggtgctgcaattgccctgcaaaaaggcctt
cacggtattaattttaatgagtgggttaatgtcctttacggactggcactgtccctggta
ttgggtttcgcaacgggatggacggttgtaaagctggttgagaagatttttagaagagtc
aacagggcaaaaacttttgggtttttcaaaaatgcccaggttttggccagtgccggcatg
gcatttatgcatggcgcgcaggacggacagaaatttatgggtgtgtttatgctgggtgtg
tttttaacgcagggacaagcacaagtgacagaatttatcataccgaactggatgcttatt
ctttgctcggcagtcatggccacaggtacttccattggcggatatcgaattattaaggcc
gtaggaatggacatggtcaaacttgaaaaatatcaaggtttttctgccgaccttgccggc
gtgatatgtttgcttacagcatcagttttcggcttgccggtcagtaccactcataccaag
acaacggcaattatgggcgttggagcggcaaaacgtatatcttcagttaactggggagtg
gtaaaagagatggtgtccgcatgggttctgactttcccgggatgcggattgataggcttt
ttgatggcattgctctttatgaacatattttaa

DBGET integrated database retrieval system