KEGG   Pseudoclostridium thermosuccinogenes: CDO33_01020Help
Entry
CDO33_01020       CDS       T05300                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cthd  Pseudoclostridium thermosuccinogenes
Pathway
cthd00450  Selenocompound metabolism
cthd00970  Aminoacyl-tRNA biosynthesis
cthd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cthd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CDO33_01020
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CDO33_01020
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cthd01007]
    CDO33_01020
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cthd03016]
    CDO33_01020
Enzymes [BR:cthd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CDO33_01020
Amino acid related enzymes [BR:cthd01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CDO33_01020
Transfer RNA biogenesis [BR:cthd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CDO33_01020
 Prokaryotic type
   Other AARSs
    CDO33_01020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AUS95150
UniProt: A0A2K2FQ96
Position
229500..231500
Genome map
AA seq 666 aa AA seqDB search
MREEADLEKKTFYITTPIYYPSDKLHIGHSYTTVAADAVARYKRLKGYDVMFLTGTDEHG
QKIQRKAEEKGVTPKQYVDGIVSGIKDMWKLMDISNDRFIRTTDEYHIKSVQQIFKKLYD
QGDIYKSEYEGWYCTPCESFWTKTQLVDGKCPDCGREVELTKEESYFFRLSKYQDKLIKY
IEEHPDFIQPVSRQNEMLNNFLRPGLEDLCVSRTSFDWGIPVTFDEKHVVYVWIDALSNY
ITALGYGSSDDSDYKKYWPADVHLVGKEIVRFHTIIWPAMLMALGEPLPKQVYGHGWLLL
EGGKMSKSKGNVVDPVILVEKYGLDAIRYFLLREVPFGSDGVFSNEALINRINSDLANDL
GNLVSRTVAMIDKYFGGTLPSEKVSGDFDEDLKKMVTELTPKVEELMDKLQFSSALAEIW
KVISRTNKYIDETMPWVLAKDEASKPRLAAVLYNLAESLRVISILLQPFMTQTPAKIWHQ
LGLAGSDVLTWESARVWGGYPEGISVNKGEVIFPRIDVKKEMEELEKLTAAKDENKADNS
GDKDKSQKGGKEDKAEKQQEMITIDDFAKLDLRVAKVLEAEKVEGADKLLKLKLEVGSET
RQVVSGIAKHYAPQDLIGKTIILVANLKPVKLRGIESQGMILAATDENGLVLATTDKPIK
SGSKIS
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
ataagggaggaagcagatttggaaaaaaagacattttatattacgacgccgatatactac
cccagtgacaaattacatataggccattcctataccacagttgcagcggatgccgtggca
aggtacaaaaggctcaaaggctacgatgtgatgtttcttaccggaaccgatgagcatgga
caaaaaattcagagaaaggccgaagaaaaaggcgttactccaaaacaatacgtggatgga
atcgtgtccggcattaaagatatgtggaagctgatggatataagcaacgacaggtttata
aggacaaccgacgagtaccatataaaatccgtccagcagatattcaaaaagctttatgac
cagggagatatatataagagcgagtacgaaggttggtactgtaccccctgtgaatccttc
tggacaaagacccagttggtagacggaaaatgccctgactgtgggagggaagtggagctt
accaaagaggaaagctatttcttcaggctttccaagtaccaggacaagcttataaaatac
atagaggagcatccggacttcatacagccggtttcaaggcagaatgaaatgctcaacaac
tttctgcgcccagggctggaagacctctgtgtttccagaacctctttcgattggggaata
ccggtgacttttgacgaaaaacacgtagtctatgtctggatagatgccctttccaactat
attaccgctttgggatacgggtcttcggatgattccgattataaaaaatactggcctgcc
gatgtacatctggtaggaaaggaaatagtccgtttccatacaatcatatggccggcaatg
ctcatggcccttggagaaccactgccgaagcaggtttatggacacggatggctgctgctg
gaaggcggcaaaatgtccaaatccaaaggaaatgtcgtagatccggttatattggtggaa
aaatacggccttgatgcgatccggtacttccttttgagagaagttcccttcggttcggat
ggggtattctccaacgaagcgctgataaacaggattaattcggaccttgccaacgacctg
ggaaatctggtcagcagaacggtggcaatgattgataaatatttcggtggtaccctgcct
tcggaaaaggtgtccggagatttcgacgaggatttgaagaagatggtgacagagttgacg
cccaaggtggaggagcttatggacaaactgcagttcagctcagccctggcggagatttgg
aaggtaatatccaggacaaacaaatatattgacgaaacaatgccatgggtattggccaag
gatgaagcgagcaagccaaggcttgcggcagttttgtacaatcttgccgagagcctcagg
gtgatttccatactgctgcagcccttcatgacccagactcccgcaaagatttggcatcag
ttgggactggccggctccgatgttcttacatgggaaagcgcccgcgtttggggcggatat
ccggaaggcatatcggtcaacaagggcgaggtcatattccccagaatcgacgtgaagaaa
gaaatggaggagctggagaagctgactgcagccaaggatgagaataaggccgataactcc
ggggataaggataaatcccaaaagggcggcaaggaggataaggctgaaaagcagcaggag
atgattacgatagatgattttgcaaagctggacttgagagtagcaaaggtgctggaagca
gaaaaggtggaaggcgccgacaagctgctgaaactcaagctggaagtgggaagcgaaacc
agacaggtggtgtccggcatagcgaagcattacgctccccaggatctcataggcaagacc
atcatactggtggcaaaccttaagcctgtcaaactcaggggaatagaatcccagggtatg
atcctggcagcgacggatgaaaacggactggttctggcaaccaccgacaaacccataaaa
tcaggctctaagataagctaa

DBGET integrated database retrieval system