KEGG   Chroococcidiopsis thermalis: Chro_0112Help
Entry
Chro_0112         CDS       T02360                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
cthe00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Chro_0112
Enzymes [BR:cthe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Chro_0112
Transporters [BR:cthe02000]
 Other Transporters
  Pores ion channels [TC:1]
   Chro_0112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 GST_C_6 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AFY85669
UniProt: K9TUJ0
Position
135164..135727
Genome map
AA seq 187 aa AA seqDB search
MLKLYGGAFSRAAIVQWYLEELEVPYEFVMLDMKAGEHLQPAYLAINPFGKVPAIVDGDV
RLWESGAILAYLADKYEKAELSLEERAQLSQWILFANATLGPGIFVEANRDREMPRLMTT
LNQILEQQSYLLGQQFSAADVAVGSLLSYIPIMLKLDLSGYPAVVGYVKRLAERPAFQKS
IGSRRGG
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagctttatggtggtgcttttagccgtgccgcgatcgttcaatggtatttggaa
gaactagaagttccctacgaatttgtcatgctggatatgaaagcaggagagcatctccag
ccagcatatcttgccattaatccctttggtaaagttccagcaattgtagacggagatgtc
cgactgtgggaatctggagcaattctcgcctatcttgccgacaaatacgaaaaagccgag
ctgtccttagaagaacgcgctcagctgagccaatggattttatttgctaatgccacactg
ggaccaggaatttttgtggaagcaaaccgcgatcgcgaaatgccgcgtctgatgactact
cttaatcaaattctagagcagcaatcttatttgctcggtcaacagtttagtgcagctgat
gtcgcggtcggctctctcttaagttacattccaatcatgttaaagctagatctgagcgga
tacccagcagttgttggctatgtcaaaagactcgccgaacgtccggcatttcaaaagtca
attggctctcgccgtggtgggtga

DBGET integrated database retrieval system