KEGG   Chroococcidiopsis thermalis: Chro_0347Help
Entry
Chro_0347         CDS       T02360                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridin epyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
cthe00790  Folate biosynthesis
cthe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Chro_0347
Enzymes [BR:cthe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Chro_0347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: AFY85899
UniProt: K9TV76
Position
complement(378847..379365)
Genome map
AA seq 172 aa AA seqDB search
MTNYQLPITNYQLPITNCAIALGSNLGDSLAIVEAALATLAEMPEIAIAAKSSWYRTKAV
GPPQPDYINGCAVLQVQLSPQELLDILLATEAKFGRVRQERWGARTLDIDLLLYDDLILD
TPNLTLPHPRMRERAFVLVPLAEIAPNWIDPVSGKAIATLLQAVDCTGVSYQ
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaactaccaactaccaattaccaattaccaattaccaattactaattgcgcgatc
gccctgggaagtaatcttggtgattctttggctattgtggaggctgctttagcaacttta
gccgagatgcctgagattgcgatcgcagcaaagtctagctggtatcgcacgaaagcagtg
ggaccacctcagccagactatattaatggttgtgcagtacttcaggttcaactgtctccc
caggaattgttagatattctactggcaactgaagcaaaatttgggcgcgtgcgccaagaa
cgttggggcgcgaggacgcttgacattgacctgctgttgtacgacgatcttattctcgat
actcctaaccttaccctacctcatccccgcatgagagaacgcgcttttgttctcgtccca
ttagcagaaattgcccccaattggatcgatcctgtatctggtaaagcgatcgccacgcta
cttcaagctgtagactgtactggagtcagttatcagtga

DBGET integrated database retrieval system