KEGG   Chroococcidiopsis thermalis: Chro_0350Help
Entry
Chro_0350         CDS       T02360                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase (decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
cthe00030  Pentose phosphate pathway
cthe00480  Glutathione metabolism
cthe01100  Metabolic pathways
cthe01110  Biosynthesis of secondary metabolites
cthe01120  Microbial metabolism in diverse environments
cthe01130  Biosynthesis of antibiotics
cthe01200  Carbon metabolism
Module
cthe_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cthe_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cthe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Chro_0350
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Chro_0350
Enzymes [BR:cthe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     Chro_0350
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     Chro_0350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 NAD_binding_11 F420_oxidored Shikimate_DH 2-Hacid_dh_C 3HCDH_N PGK
Motif
Other DBs
NCBI-ProteinID: AFY85902
UniProt: K9TSV9
Position
381933..383429
Genome map
AA seq 498 aa AA seqDB search
MAQQSFGVIGLAVMGENLALNVERNGFPIAVYNRTPEKTNAFMTERAQGKNAVATYSLEE
FVNALERPRKILIMVKAGAPVDAVIQQLKPLLDEGDIIIDGGNSLYDDTARRTRELEPEG
FRFIGMGVSGGEEGALNGPSLMPGGTKSSYEYLSPIFNKIAAQVEDGPCVTYIGPGGAGH
YVKMVHNGIEYGDMQLIAEAYSLLKDGLGLDNRQLHEIFAEWNTTEELDSYLIEITADIF
RYIDPDTKNHLVDMILDSAGQKGTGRWTVQSALEFGVCIPTITAAVNARIMSSYKQERVA
ASQMLPGPTGTYQGDPKAFINMVRDALYCSKICSYAQGMALLATASKEYSYDLNLSEMAR
IWKGGCIIRARFLGKIQSAFIENPNLPNLLLAPEFRQTILDRQDAWREVLAAAAKLGIPV
PAFSASLDYFDSYRRDRLPQNLTQAQRDYFGAHTYERTDKEGFFHTEWTKFSEESVQTST
PEPLQADQPTTPQPTGSR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcaaagctttggtgtgattggactagcggtaatgggtgaaaaccttgcccta
aacgtcgagcgtaatggttttcccatcgcagtttacaatcgcactcccgaaaaaaccaat
gcattcatgacagagcgggcgcagggcaaaaatgccgttgctacctactctttagaagaa
tttgtcaatgcgctagaacgcccccgcaagattttgatcatggttaaagctggtgcgcca
gtggatgcagtaattcagcagctcaaacccttgttggatgaaggcgacattatcattgat
gggggcaactcgctgtatgacgatacggcgcgacgcactcgcgaattagaaccagaaggc
ttccgctttatcggtatgggcgtaagtggaggtgaagaaggggcattgaatggtcctagc
ttaatgccagggggaacgaaaagttcctacgaatatttgtcaccgatttttaataaaatt
gccgctcaagtagaagacggtccctgcgtgacttatatcggtcctgggggcgcaggtcac
tacgtcaaaatggttcacaatggcattgagtacggcgatatgcagttgattgccgaagcc
tacagcctcctcaaagatggtttgggtttggataatcggcaactgcacgaaatttttgcc
gagtggaatactaccgaagaactcgattcctatttgattgaaatcactgcagatattttc
cgctatatcgaccccgacaccaaaaatcacttggtcgatatgattctcgattctgccgga
caaaaaggtacggggcgctggacggtgcaaagtgctttggagtttggcgtatgtattccc
acgattacggcagcggtgaacgcgcggattatgtcctcttacaagcaagagcgagtagct
gcatcccaaatgttacccggtcctacaggcacgtatcaaggcgatccgaaggcattcatc
aatatggtgcgggatgcattatattgttctaaaatctgctcttatgctcaaggaatggcg
ctgttagcgacagcatccaaagagtattcttatgacctgaatttgagcgaaatggcgcgg
atttggaaaggcggctgtattattcgcgctagatttttaggtaagattcagagtgctttc
attgaaaatccgaacttacccaacttgctgttggctccagagtttagacaaacaattctc
gatcgccaagatgcatggcgggaagttttagcagcggcggcgaaactcggcattcccgta
cctgcatttagtgcgtcgttagattattttgacagctacagacgcgatcgcttgccccaa
aacctgacgcaagctcaacgcgactacttcggcgctcacacttacgaacgtactgacaaa
gaaggcttcttccataccgagtggacgaagttctctgaggaatcggtacaaacttctacc
ccagaaccgctacaagcagatcagccaacgactcctcaaccaacgggaagtcgttag

DBGET integrated database retrieval system