KEGG   Chroococcidiopsis thermalis: Chro_1312Help
Entry
Chro_1312         CDS       T02360                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
cthe00260  Glycine, serine and threonine metabolism
cthe00750  Vitamin B6 metabolism
cthe01100  Metabolic pathways
cthe01110  Biosynthesis of secondary metabolites
cthe01120  Microbial metabolism in diverse environments
cthe01230  Biosynthesis of amino acids
Module
cthe_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Chro_1312
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Chro_1312
Enzymes [BR:cthe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Chro_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NinF zinc_ribbon_2
Motif
Other DBs
NCBI-ProteinID: AFY86838
UniProt: K9TWT2
Position
complement(1455159..1456460)
Genome map
AA seq 433 aa AA seqDB search
MTQAIANQTKTNATFRALKCKECGAEYELQAMHVCEYCFGPLEVAYDYSALRDTVTRESI
QKGPHSIWRYRPFLPVATDNPIDVGTGLTPLVRANRLARRLGLKKLYIKNDAVNMPTLSF
KDRVVSVALTRARELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPADLEAGKVLGTL
IYSPTVMAVQGNYDQVNRLCSEVANTYGWGFVNINLRPYYSEGSKTLGYEVAEQLGWELP
DHVVAPLASGSLFTKIYKGFQEFTEVGLVEGKHVRFSGAQADGCSPIAQAYRDGKDFIKP
VKPSTIAKSIAIGNPADGVYALDIARKTNGNIESVSDPEIIEGIKLLAETEGIFTETAGG
TTIAVLKKLVEAGKIDPEETTVAYITGNGLKTQEAVQGYAGEPLTIEPKLDSFERALERS
RTLERLDWQQVLV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggcgatcgcaaaccaaaccaagacaaacgccacgtttagagccttgaaatgt
aaagaatgtggtgctgagtacgaactacaagcaatgcacgtttgcgaatattgctttgga
ccattggaagttgcctacgattacagcgctctgcgcgataccgtcactcgcgaaagcatt
caaaaaggaccccactcaatttggcgctatcgtccttttttacctgttgctaccgataac
ccaatcgatgtcgggactggcttaacacctttagttcgtgccaatcgcctagcgcgtcgc
ctcggactgaaaaagctttacatcaagaacgatgctgtcaacatgcctaccctgagcttt
aaagatcgggtggtatcggtagccctgactcgtgctagagagctaggctttacgacagta
tcttgtgcgagtacggggaatttagctaattctaccgcggcgatcgccgctcacgcaggt
ttagattgctgcgtctttatccccgccgatttagaagcaggtaaggttttaggaactttg
atctacagccctactgtaatggcagtacaaggtaactacgaccaagtcaaccgcctctgt
tctgaagtagcgaatacatacggctggggttttgtcaatatcaatttgcgcccctattac
tccgaaggttccaagactttaggttacgaagttgcagaacaactgggttgggaactccca
gaccacgtagttgcgcctctagcttctggttccctgttcaccaaaatctacaaaggcttc
caagaatttaccgaagttggcttagtagaaggcaagcacgtcagattcagcggcgcgcaa
gccgacggatgttcgccaattgcccaagcttacagagatggcaaagactttatcaaacca
gtaaaaccgagtacgattgctaaatcaatcgcgatcggtaatcccgctgatggtgtctat
gccttagatattgcgcggaaaacaaatggtaatattgaatcagtcagcgatcctgaaatt
atcgaaggcatcaaattactagcagaaactgaaggtatctttaccgaaaccgcaggtgga
accacgatcgccgtgttgaaaaaactggtagaagcaggtaaaatcgaccccgaagaaact
accgttgcttacatcactggaaatggcttgaagacacaagaagccgtccaaggatatgca
ggcgaacccctaacaattgagccaaaactcgatagctttgaaagagcattagagcgttct
cgcaccctcgaacgcctagattggcaacaagttttggtctaa

DBGET integrated database retrieval system