KEGG   Chroococcidiopsis thermalis: Chro_2041Help
Entry
Chro_2041         CDS       T02360                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
cthe00260  Glycine, serine and threonine metabolism
cthe00750  Vitamin B6 metabolism
cthe01100  Metabolic pathways
cthe01110  Biosynthesis of secondary metabolites
cthe01120  Microbial metabolism in diverse environments
cthe01230  Biosynthesis of amino acids
Module
cthe_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Chro_2041
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Chro_2041
Enzymes [BR:cthe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Chro_2041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: AFY87548
UniProt: K9TYT5
Position
complement(2287518..2288612)
Genome map
AA seq 364 aa AA seqDB search
MTLSLSANTSSNCQNWSGLIETYRHYLPVTDQTPVITLLEGNTPLIPAPAIAAQIGRQVR
VLVKYDGLNPTGSFKDRGMTMAISKAKEAGAKAVICASTGNTSASAAAYARRGGMRAFVL
IPDGYVALGKLAQALLYGAEILAIKGNFDRALEIVRQMAETYPVNLVNSVNPYRLEGQKT
AAFEIVDNLGNAPDWLCIPVGNAGNITAYWMGFCQYHSLGKCDRLPKMMGFQAIGAAPLV
TGQAVTHPETIATAIRIGNPASWQKAIAVQTASAGEFNAVSDAEILDAYRFLAAEEGIFC
EPASAASVAGLFKVKDRVPSGATVVCVLTGNGLKDPDTAINHSQNTFKQGIEPTLDSVAK
VMGF
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgactctaagcctgtctgctaatacatcatcaaattgccaaaattggtctggactgata
gaaacatatcggcactatttgcctgttaccgaccaaactccagttataactttattagag
gggaacacacccctaattcccgcccctgcgatcgcggctcaaattggcagacaggtgcgc
gtactcgttaagtatgatggattgaaccccacgggtagcttcaaagaccgaggcatgacg
atggcaatctccaaggcaaaagaagccggagccaaagctgtcatttgtgccagtacgggc
aatacctcagcatcagcagcagcttacgcgcgacgcggcggaatgcgagctttcgtctta
attcccgatggctacgtcgctctaggaaaactagcacaagctttgctgtatggagcagaa
atactagcaatcaaaggcaacttcgatcgcgccctagaaattgtgcgccagatggcagag
acttatccagtgaatttggtgaattcggtcaatccctatcgtttagaagggcagaaaacc
gcagcatttgagattgttgacaatttaggcaacgcccccgactggttgtgcattcccgta
ggcaatgcaggaaacatcactgcatattggatgggattttgtcaatatcatagtctaggg
aagtgcgatcgcttacctaaaatgatgggatttcaagcaattggcgctgctcctttagtc
acgggacaagccgtaactcaccctgagacaattgctacagctatccgcattggcaacccc
gccagctggcaaaaagcgatcgcggtacaaacagctagtgcgggagaattcaatgctgtc
agcgatgccgaaattttggacgcataccgttttctcgctgccgaagaaggcattttctgc
gaacctgccagcgctgcttctgtggctggattattcaaggtgaaagatcgagttcctagt
ggtgcaaccgttgtttgcgttttaaccggaaacggcttgaaagacccagacacagccatc
aaccacagccaaaatacgtttaagcaaggcattgagccgacattggactcggtagcaaaa
gtcatgggattttaa

DBGET integrated database retrieval system