KEGG   Chroococcidiopsis thermalis: Chro_2177Help
Entry
Chro_2177         CDS       T02360                                 

Definition
(GenBank) Cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
cthe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Chro_2177
Enzymes [BR:cthe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Chro_2177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N Pyr_redox_2 FAD_binding_3 NAD_binding_8 TAT_signal FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AFY87679
UniProt: K9U0B0
Position
complement(2439860..2441428)
Genome map
AA seq 522 aa AA seqDB search
MKNRFRSRRRFLQTTALISASAALSPLASIYRASAQDRNVPDEAVEALVLGSGFGGAITA
LRLTQAGIRTLMIERGIRWPIRDDGNTFATFQQIDGRAAWLSNTTWNGVPVDPFTGVLDF
SQENGINILHGAGFGGGSLVYNAITYQPRREIFSGIFSPDVVDYDELDAVYYPRVRSLLQ
PASIPDDILASPYYDRARLLIEQGNRAGFATYPYNLAVDWNIIRQEIEGTKIPSAILGNH
WYGINSGAKNSLDRNYLFQAEQTGLLDVLTLHLATDITEVPEYGYRVLCTQIDTSGAVVA
QKSFTCRYLFLAAGSIGTSKLLVRSKATGLLPKLNDEVGKHWGGNGDAIVTRSNLLPSVS
GKGGPACVVLEHLDNPLGATVFEDIPDANAADGTLQLLALGIPRQTGTFTYNASTDSVRL
NWTQDNAQLDAVKLTAQILDEKNTTSTSQPTSAFINSISGHPLGGATLGKACDRYGRVAG
YKRLYVMDGAMIPGYTAITNPSFTIAALAERNIEKIIAEDLG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaagaataggtttcgcagccgtcgtcgctttctgcaaactactgcacttatttctgct
agtgctgccctaagtccgctagctagtatttatcgcgcgagcgcccaagatcgaaatgtt
ccagatgaagctgtagaagctctagtccttggtagcggttttggcggagcgattacggct
ctgcgcttgacacaagctgggattagaacattgatgatagagcgaggaatccgctggcct
atcagagatgatggaaatacttttgctacttttcaacaaatagatggtcgagctgcctgg
ttaagtaatacgacatggaatggagttcccgtcgatccgtttacaggagtgctagacttt
tctcaggaaaatggaattaatatcttgcatggggctggctttggaggtggatcgttagtt
tataacgcgattacttaccaacccaggcgcgaaatcttcagcggtattttttctcctgat
gttgtggactatgatgaattggatgcagtttattatccgcgcgtgcgatcgctcctacaa
cccgcaagcattcctgatgatattttggcaagtccttactacgatcgcgctaggttatta
atcgaacaaggaaatagagcaggctttgctacatatccatataatcttgcagtagattgg
aatataattcgccaagaaatagaaggaacaaagataccttctgcaattctaggtaatcac
tggtacggcattaacagtggggctaaaaatagcctggatcgtaactacctatttcaggca
gagcaaactggattattagatgttttaacattacatctagctacagatattactgaagta
cctgaatatggatacagagttttatgtactcaaattgacacatcaggagcagtcgtcgct
cagaagtctttcacctgtcgctatttatttttagcagctggttctattggaacttccaag
cttttagttagatctaaagcaacgggcttattaccaaaattaaacgatgaagttggcaaa
cattggggaggtaatggagatgcgattgtaactcgtagcaacttattgccgtctgtatct
ggtaagggaggaccagcatgtgtagttttggaacacctagataaccctcttggtgcaact
gtttttgaggatattccagatgcaaatgcagctgatggtacgctacagttactcgcttta
ggtatacctcgacaaacagggacatttacatataacgcatctactgattctgtccgcttg
aactggactcaagacaatgctcaattagatgctgtcaagttaactgctcaaatccttgac
gagaaaaatacgacctctaccagtcagcctacatcagcatttatcaattccatctctggg
catcctctaggaggagcaacactaggaaaagcctgcgatcgctacgggcgcgtcgctggg
tataaacgtctttatgtcatggatggagccatgattcctggctatacagctatcacaaat
ccttcctttactattgcggctttagcagaacgcaatatagaaaaaatcattgctgaagat
cttggatag

DBGET integrated database retrieval system