KEGG   Chroococcidiopsis thermalis: Chro_2639Help
Entry
Chro_2639         CDS       T02360                                 

Definition
(GenBank) oxidoreductase domain protein
  KO
K00214  biliverdin reductase [EC:1.3.1.24]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
cthe00860  Porphyrin and chlorophyll metabolism
cthe01100  Metabolic pathways
cthe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cthe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Chro_2639
Enzymes [BR:cthe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     Chro_2639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA NAD_binding_3 F420_oxidored Shikimate_DH OCD_Mu_crystall Sacchrp_dh_NADP Semialdhyde_dh NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AFY88114
UniProt: K9U1J7
Position
complement(2949474..2950451)
Genome map
AA seq 325 aa AA seqDB search
MLDDQIQIGIVGTGYAAKLRAESFGRDERSRVVAIAGHTPEKTATFSQTYQAQAVDSWQQ
LVAREDIDLVVICTINSDHGAIAKAALQNHKHVVVEYPLALDVAAAEEIIALAKTQNRLL
HVEHIELLGGLHQALKQYLPQVGSPFYARYSTMNPQRPAPRRWTYNQEMFGFPLCGALSR
IHRLTDLFGTVETISCQNRYWGTDPESFFQVCLCTAQIRFTSGAIAEVSYGKGETLWQNE
RKFEVHADKGGLIFDKDDGVLIQAEETTKIDIGSRRGLFAKDTGMVLDHLHMGVPLYVSP
TESLYALKVADAARRSAQIKETIVM
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgaccaaattcagatcggaatagtaggtactggctatgcagcgaagttaaga
gcagaatcttttggaagagacgagcgatcgcgtgtcgttgcaattgctgggcatactcct
gaaaagacagcaacttttagtcagacatatcaagcccaagcggttgattcttggcaacag
ttagtagcaagggaagatatagatctcgttgttatctgtacgattaactcagatcatgga
gcgatcgccaaagctgctttacagaaccacaagcacgtcgttgtagaatatcctttggct
ttggatgtagcggcagcagaggaaattattgctctagctaaaactcaaaatcggttattg
cacgtcgaacatatcgagttactgggtggcttgcaccaagccttaaaacagtatttaccg
caagttggtagcccgttctacgcccgttacagcacgatgaatccccaacgccccgcacct
cgacgttggacttacaatcaagagatgtttggctttcctctatgtggtgcgctatcgaga
atccatcgccttacagatttattcggtacggttgagactatcagttgtcaaaatcgttat
tggggtacagatcccgagtcattttttcaagtgtgtttgtgtactgcacaaattcgattt
actagcggagcgattgccgaagttagttatggtaaaggggaaactttgtggcaaaacgag
cgcaaatttgaggttcacgccgataaaggtggtttaatttttgataaggatgatggcgtt
ttaattcaagcagaggaaacaacaaaaattgacattggttctcgacgtggattatttgct
aaagatacaggtatggtattagaccatttacatatgggtgtgcctttgtatgtgtctcca
actgaaagtttatatgctctgaaagttgcagatgcagcgcggcgatcggctcagataaaa
gagacgattgtgatgtag

DBGET integrated database retrieval system