KEGG   Chroococcidiopsis thermalis: Chro_3209Help
Entry
Chro_3209         CDS       T02360                                 

Definition
(GenBank) gid protein
  KO
K04094  methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase [EC:2.1.1.74]
Organism
cthe  Chroococcidiopsis thermalis
Brite
KEGG Orthology (KO) [BR:cthe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cthe03016]
    Chro_3209
   03036 Chromosome and associated proteins [BR:cthe03036]
    Chro_3209
Enzymes [BR:cthe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.74  methylenetetrahydrofolate---tRNA-(uracil54-C5)-methyltransferase (FADH2-oxidizing)
     Chro_3209
Transfer RNA biogenesis [BR:cthe03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    Chro_3209
Chromosome and associated proteins [BR:cthe03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    Chro_3209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GIDA DAO FAD_binding_2 Pyr_redox_2 AlaDh_PNT_C FAD_oxidored NAD_binding_8 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AFY88674
UniProt: K9U361
Position
3583633..3585000
Genome map
AA seq 455 aa AA seqDB search
MTNDNVIQVIGGGLAGTEAAWQIAQAGIPVILHEMRPLRSSPAHHTEHLAELVCSNSFGA
QASDRASGLLHEELRQLGSVVIGKADSHAVPAGGALAVDRGQFSQDLTETLSRHPLIELR
RGELHAIPEGVVVLATGPLTSPDLAADLHRFTGMEYLSFFDAASPIIVGESIDRDIAFLA
SRYDKGDAAYLNCPMNKEQYLQFWQALCTAEQAELKDFERENAKFFEACLPIEELARRGE
DTMRYGPLKPVGLFDARKGDFRAPENQSERPYAVVQLRQEDKAGQLWNMVGFQTNLRWGE
QKRIFQMIPGLENAEFVRLGVMHRNTFINAPQLLQPSLQFKNRPTLLGAGQLIGTEGYTA
AAAGGWLAGTNAARIALGKDSLVLPPTTMMGALFEFISSAAPKHFQPMPPNFGILPELGE
KIKNKQLRYGRYRDRSLFDLASWKAGLSLGLAGVI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatgacaacgtaattcaagttatcggtggtggattagccgggacagaagcggcg
tggcaaattgcccaggcgggaataccagtgattttgcacgaaatgcgtcctttgcgatcg
agtcccgcccaccatacagaacatttagcagaattagtctgtagcaattcttttggggcg
caagcaagcgatcgcgcatcgggattgttgcacgaagaactgcgtcaattgggttctgta
gtgattggcaaagccgacagtcacgccgtccctgctggtggtgctttagctgtagatcga
ggacaatttagccaagatttgaccgaaacgctctctcgtcaccccctcatcgaactgcgg
cggggcgaacttcacgccattccagaaggcgttgttgtactagcgactggtcctttaact
agccccgatttagccgcagatttgcaccgctttacgggaatggaatatctcagctttttc
gatgccgcaagcccaattattgtaggagaatcaattgaccgcgatattgcttttctcgct
tctcgctacgacaagggagatgcagcctatctcaactgtccgatgaataaagagcaatac
ttgcagttttggcaagcattatgcacggcagaacaagcagaattaaaggattttgagcga
gaaaatgctaaattctttgaagcttgtttacctatagaagaacttgcccgacgcggggaa
gataccatgcgctatggtcccctcaaacctgtgggcttgtttgatgcccgcaagggagac
ttccgcgccccagaaaatcagtcggaacgtccttatgcggtagtacaactgcgccaagaa
gataaggcggggcagttgtggaatatggttggatttcagacaaatttacgctggggcgaa
caaaagcgtatatttcaaatgattccaggtttggaaaatgctgaatttgtgcgtttggga
gtgatgcaccgcaacacgtttattaatgctcctcagttgttgcaaccatcattacaattt
aaaaaccgtccgactctcttaggtgcgggacaattaattggtacggaaggttatacagca
gcagcggctggcggctggctggcgggaacgaatgcggcgagaattgctttgggtaaagat
tcgttagttttaccacccacaacgatgatgggggcgttatttgaatttatcagttctgct
gccccgaaacattttcaaccgatgccacctaattttggcattttgcctgagttaggcgag
aagattaagaataaacagcttagatatggtaggtatcgcgatcgctctttgttcgatctt
gctagttggaaagcggggttatctttgggattagctggggtaatttag

DBGET integrated database retrieval system