KEGG   Chroococcidiopsis thermalis: Chro_4920Help
Entry
Chro_4920         CDS       T02360                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
cthe00471  D-Glutamine and D-glutamate metabolism
cthe00550  Peptidoglycan biosynthesis
cthe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cthe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Chro_4920
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Chro_4920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cthe01011]
    Chro_4920
Enzymes [BR:cthe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Chro_4920
Peptidoglycan biosynthesis and degradation proteins [BR:cthe01011]
 Precursor biosynthesis
  Amino acid ligase
   Chro_4920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C F420_oxidored 2-Hacid_dh_C XdhC_C TrkA_N NAD_binding_8 IlvN KbaA NAD_binding_2 FAD_binding_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AFY90299
UniProt: K9U7W2
Position
5528658..5530052
Genome map
AA seq 464 aa AA seqDB search
MSNACVIGLGKSGVAAARLLKREGWQVILSDRSDSASLRQQQQQLAAEGIPVRLGHTPSL
DSTDSPQLIVVSPGVPWDADILNRARALGIETIGEMELAWRYLNAVPWVGITGTNGKTTT
TALVAAIFQTAGLNAPACGNIGHAVCDVALEFQNNSRGAQPYAPTKYPDWIIAEISSYQI
ESAPSVAPRIGVWTTFTPDHLSRHKTLERYYDIKAHLVHQSQLQVINGDDAFLSQEKLND
WQDAYWTSVKGKAFLNCSPDLGTYIEDDWVIFGQEQIVQVSALRMVGAHNLQNLLMAVAV
ARLAGIDKEAIATAIATFPGVPHRLEHICTWQGIDFINDSKATNYDAAQVGLSSVTSPAI
LIAGGEAKIGDDLAWLQTIQAQAAAVLLIGDAAPAFASRLSQVGYNNYEIVETMARAVSR
AAELAPQYQARVVLLSPACASFDRYQNFEQRGDDFRQLCMQLVQ
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatgcttgtgtaatcggactcggaaaatctggtgttgctgctgcccgactgttg
aaacgagagggttggcaagtgatactgagcgatcgctctgattctgcatctttgcgccaa
caacagcaacaactcgcagcagaggggattccagttcgtttgggtcatactccaagttta
gacagcacggattcaccccagttaattgttgtcagtcccggcgtaccttgggatgcagac
atcttaaatcgtgccagagcattagggatcgagacgattggtgaaatggaactggcttgg
cgctatctcaacgctgttccctgggtaggaatcactggtactaacggcaaaaccacaacg
acagctttagttgctgcaatctttcaaaccgccggactcaacgcccccgcctgtgggaat
atcggtcatgccgtctgcgatgtagctttggagttccaaaataatagtaggggcgcacag
ccgtacgcccctaccaaatatcccgattggataattgccgaaatcagcagctatcaaatt
gaatctgctccctcggttgcgccgcgtatcggtgtttggacgacatttacacccgatcac
ctcagccgccacaaaactttagagcggtattacgacattaaagcgcacctagtgcatcaa
tcccaattgcaagtgattaatggcgatgatgctttcctgagccaggagaagctaaatgat
tggcaggatgcttactggacaagtgtaaaaggtaaagctttcctcaattgcagtcctgat
ttagggacttatattgaagatgattgggttatctttgggcaggagcagatcgtgcaggtg
tcggcgttacggatggtaggcgcgcacaacttgcaaaatctgctgatggcggtagcggtg
gcgcgattagcaggcattgacaaagaggcgatcgccactgcaatagctacatttccaggc
gttccccaccgcttagaacacatttgcacttggcaaggaattgattttatcaacgatagc
aaggcaactaactacgatgcggctcaagttgggttatcttctgtcactagccctgcaatt
ctgattgctggcggcgaagcaaaaattggtgatgacttagcatggttgcaaacaattcaa
gctcaagccgccgccgtcttactcattggcgatgctgcgccagcttttgcctcacgtcta
tctcaagtgggttacaacaattacgagattgtggaaacgatggcgcgtgccgtgtctaga
gccgcagaattagccccacaatatcaggcacgggttgtcttgctttctcctgcctgtgcc
agtttcgatcgctaccaaaatttcgagcaacgcggcgacgattttcggcagttatgtatg
cagttagtgcaatag

DBGET integrated database retrieval system