KEGG   Chroococcidiopsis thermalis: Chro_5405Help
Entry
Chro_5405         CDS       T02360                                 

Definition
(GenBank) sedoheptulose 1,7-bisphosphatase, D-fructose 1,6-bisphosphatase
  KO
K11532  fructose-1,6-bisphosphatase II / sedoheptulose-1,7-bisphosphatase [EC:3.1.3.11 3.1.3.37]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
cthe00010  Glycolysis / Gluconeogenesis
cthe00030  Pentose phosphate pathway
cthe00051  Fructose and mannose metabolism
cthe00680  Methane metabolism
cthe00710  Carbon fixation in photosynthetic organisms
cthe01100  Metabolic pathways
cthe01110  Biosynthesis of secondary metabolites
cthe01120  Microbial metabolism in diverse environments
cthe01130  Biosynthesis of antibiotics
cthe01200  Carbon metabolism
Module
cthe_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cthe_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
cthe_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cthe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chro_5405
   00030 Pentose phosphate pathway
    Chro_5405
   00051 Fructose and mannose metabolism
    Chro_5405
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Chro_5405
   00680 Methane metabolism
    Chro_5405
Enzymes [BR:cthe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Chro_5405
    3.1.3.37  sedoheptulose-bisphosphatase
     Chro_5405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX T2SSE_N
Motif
Other DBs
NCBI-ProteinID: AFY90769
UniProt: K9U962
Position
6081259..6082296
Genome map
AA seq 345 aa AA seqDB search
MENTLGLEIIEVVEQAAIASSRWMGKGEKNTADQVAVEAMRERMNKIYMRGRIVIGEGER
DEAPMLYIGEEVGICTRADAKDYCNPDELVEIDIAVDPCEGTNLVAYGQNGSMAVLAIAE
KGGLFAAPDFYMRKLAAPAPARGHVDINKSATQNLKILSECLGRAVEELVVVVMDRPRHK
ELIQEIRQAGARVRLISDGDVSAAISCAFSGTNIHALMGIGAAPEGVISAAALRCLGGHF
QGQLIYDPEVVKTGLIGESKEGNIARLKEMGINDPDRVYNAEELASGQTVLFAACGITPG
TLMEGVRFFKGGARTQSLVISSQSRTARFVDTIHMFDEPKTLQLK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaatactctaggtttagagattattgaagttgtagaacaagcagcgatcgcatct
tcccgttggatgggtaaaggcgagaaaaacactgctgaccaagtggctgtagaagccatg
cgggagagaatgaataaaatttacatgcggggtcggattgtcatcggtgaaggcgaacgg
gatgaagcccccatgttatacattggcgaagaagtcgggatttgtacccgtgccgatgcc
aaagattactgtaacccagatgaattagttgaaattgacattgccgttgacccttgtgaa
gggactaacttagtcgcctacggacaaaacggctcgatggctgtgttggcgatcgccgaa
aaaggtggtttgtttgctgctcctgacttttacatgagaaagctcgcagcaccagcccca
gcacgcggtcatgtcgatattaataaatcggctacccaaaacctcaaaatcctctcagaa
tgcctcggacgcgccgtagaggagctagttgtggtcgtgatggatcgccctcgccacaaa
gaactcattcaagaaattcgtcaagcaggggcaagagtacgcttaattagcgatggtgat
gtctccgccgcgatctcctgcgctttctcgggaacgaacattcatgccttgatgggaatt
ggcgcagctccagaaggcgtgatttctgctgctgcattgcgctgtttgggcgggcatttc
caaggacaattgatctacgatccagaggtagtcaaaactggtttgattggcgaaagtaaa
gagggaaatattgcccgtttgaaagaaatgggaattaatgacccagaccgagtttacaat
gctgaagagttagcttcgggtcaaaccgtcctgttcgctgcttgtggtattaccccaggt
acgctgatggaaggtgtccgcttcttcaaaggtggagccagaacccaaagtttagttatc
tccagccaatctcgcacggcgcggtttgtagacacgatccatatgtttgacgaaccaaag
acactgcaactgaagtag

DBGET integrated database retrieval system