KEGG   Chlamydia trachomatis RC-F(s)/852: CTRC852_02815Help
Entry
CTRC852_02815     CDS       T02765                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cthf  Chlamydia trachomatis RC-F(s)/852
Pathway
cthf03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cthf00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CTRC852_02815 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cthf03011]
    CTRC852_02815 (rplV)
Ribosome [BR:cthf03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CTRC852_02815 (rplV)
  Bacteria
    CTRC852_02815 (rplV)
  Archaea
    CTRC852_02815 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Bac_DNA_binding
Motif
Other DBs
NCBI-ProteinID: AGR95801
Position
complement(596712..597047)
Genome map
AA seq 111 aa AA seqDB search
MFKATARYIRVQPRKARLAAGLMRNRSVVEAQQQLSFSQMKAGRCLKKVLDSAIANAESN
ENIKCENLCVLEVRVDAGPMFKRMKSKSRGGRAPILKRTSHLTVIVGERGQ
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagcgacagcccgatacatacgggttcagccaagaaaggctcgtttagctgca
ggattgatgagaaaccgtagtgttgttgaagctcaacagcaactcagcttttctcagatg
aaggctggaagatgccttaaaaaagtgttggatagcgctattgcaaatgcagagtccaat
gaaaatataaaatgtgaaaatctttgcgttctagaagttcgggttgatgccggcccaatg
ttcaaaagaatgaagtctaagagtcgtgggggaagagccccgattttgaagcgcacgagt
catctaactgtgattgttggcgagagagggcagtag

DBGET integrated database retrieval system