KEGG   Caldimicrobium thiodismutans: THC_0024Help
Entry
THC_0024          CDS       T04224                                 

Definition
(GenBank) phosphoesterase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
cthi  Caldimicrobium thiodismutans
Brite
KEGG Orthology (KO) [BR:cthi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    THC_0024
Enzymes [BR:cthi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     THC_0024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP RPAP1_C
Motif
Other DBs
NCBI-ProteinID: BAU22431
UniProt: A0A0U5AVN6
Position
24888..25736
Genome map
AA seq 282 aa AA seqDB search
MIDLHTHSTASDGTYSPSELVHLAKKEGLKALALTDHDTLQGLKEAYETSQVEGLEFLCG
VEISIKIEGPGHFHLLGYFLTPEIPSLETTLLSLQKARDKRNKLMLEKLQALGIDITLEE
LENIAQGEIGRPHFAKLLIQKGVVKTFQEAFDRYLKKGAPAYVPKALLTPEEGINKILQS
GGIPVLAHPITLKLNEKELSNYLAKLKELGIKGVEVYYSEHSKTFTEFLYTVAKRLDLLI
TGGSDFHGTNKPDIKLGRGFGNLKIPYEVFLKLKEALEKISS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgatagatttacatacccattctacagcctcagatggaacctattctccatccgagctt
gtgcatcttgctaaaaaagaaggcctcaaagccttagctttaactgatcatgatacccta
cagggattaaaggaagcttatgaaacctcgcaggtagaaggcttagagtttctctgtggg
gttgaaataagcattaaaatagagggcccagggcactttcaccttcttgggtatttttta
acaccggagataccatccttggagacaacccttctttctcttcaaaaggcaagagataaa
agaaacaagttaatgcttgaaaaattgcaggctcttgggattgatattactctggaagag
cttgaaaatattgcacagggcgagattggaaggcctcattttgccaagcttcttattcaa
aagggagtggtaaagacctttcaagaggcctttgatagatatcttaaaaaaggtgctcca
gcctatgtccctaaagcccttttaactccagaagagggaatcaataaaattcttcaaagt
ggtggtattcctgttttggcgcatcctatcactctaaagttaaatgaaaaggaactaagt
aattatttggctaagcttaaagaactgggaataaaaggtgtagaggtttattactctgag
cattctaaaacctttacagagtttctctatacagtggctaagcgtttagatcttcttatc
acaggggggagtgactttcatggcacaaataaacccgatataaaacttggtcgcggtttt
ggtaatttgaaaataccctatgaggtttttctgaaacttaaagaggcccttgaaaaaatt
agctcttga

DBGET integrated database retrieval system