KEGG   Caldimicrobium thiodismutans: THC_0043Help
Entry
THC_0043          CDS       T04224                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
cthi  Caldimicrobium thiodismutans
Pathway
cthi00540  Lipopolysaccharide biosynthesis
cthi01100  Metabolic pathways
Module
cthi_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:cthi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    THC_0043
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:cthi01005]
    THC_0043
Enzymes [BR:cthi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     THC_0043
Lipopolysaccharide biosynthesis proteins [BR:cthi01005]
 Unusual sugar
  THC_0043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD Polysacc_synt_2 KR RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: BAU22450
UniProt: A0A0U5AKL0
Position
complement(44992..45975)
Genome map
AA seq 327 aa AA seqDB search
MKTGRIVVTGGAGFIGSNVVKALNDRGETRILIVDHLSQGPKWKNLVGLRFEDYLDREDF
LKSIEENKFYDLKAIIHLGACSDTTVHDLHFLYKNNYVYSQKLCLYALKNGIRFVYASSA
ATYGDGSLGFNDDEEQLYELKPLNPYGFYKHLFDLWAYQKGFLNSIAGLKYFNVFGDREF
HKGDMRSVALKAYEQIKKDGKVRLFKSYHPDYEDGGQLRDFIYVKDAVEVTLFFMEHPQI
NGIFNVGTGKARSFKDLVIAVFKALDLPPKIEYIDMPEQLKKQYQYFTEANLSKLRKVGY
NSPMLELEEAIKEYVKFLEEHSKYFLG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccggaagaatcgttgtaactggaggagcaggatttataggttcaaatgtagtg
aaggctctcaatgatagaggcgagacgcgaattctgattgtggatcatctttctcagggt
cctaagtggaaaaatctggtaggcctaagatttgaagattatcttgatcgggaagatttt
cttaagtctattgaagagaataaattttatgatcttaaagctataatacatcttggtgcc
tgcagtgatacaaccgtgcatgatctccattttctttacaaaaataactatgtttattct
cagaagctttgtctttatgccctgaaaaatgggattagatttgtctatgcctcatcagca
gctacttatggggatggatctttgggttttaatgatgatgaggagcagctttatgaactt
aaacctctgaatccatatggattttataaacacctctttgatctctgggcttatcaaaag
ggatttcttaattcaatagctgggttaaagtactttaatgtctttggagatagagaattt
cataaaggagatatgcgaagtgttgctcttaaggcttacgagcagattaagaaggatggg
aaggtaaggctttttaaatcttatcacccagattatgaagatggtggacaactgagagat
tttatctatgttaaagatgcagtagaggttaccctctttttcatggaacaccctcaaatt
aatggaatctttaatgtaggcacaggtaaggccagatcctttaaagaccttgtaatcgca
gtatttaaggccttggatcttccccctaaaattgaatacatagatatgccggaacaacta
aagaaacaatatcaatatttcactgaagcaaatcttagcaaattaagaaaagttggttat
aatagtcccatgctggaacttgaagaggcaattaaggaatatgtaaaattcttagaagaa
cattctaaatatttcttggggtaa

DBGET integrated database retrieval system