KEGG   Chlamydia trachomatis RC-J/953: CTRC953_00955Help
Entry
CTRC953_00955     CDS       T02767                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cthj  Chlamydia trachomatis RC-J/953
Pathway
cthj00030  Pentose phosphate pathway
cthj00480  Glutathione metabolism
cthj01100  Metabolic pathways
cthj01110  Biosynthesis of secondary metabolites
cthj01120  Microbial metabolism in diverse environments
cthj01130  Biosynthesis of antibiotics
cthj01200  Carbon metabolism
Module
cthj_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cthj_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cthj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CTRC953_00955
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CTRC953_00955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cthj04147]
    CTRC953_00955
Enzymes [BR:cthj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     CTRC953_00955
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     CTRC953_00955
Exosome [BR:cthj04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CTRC953_00955
  Exosomal proteins of colorectal cancer cells
   CTRC953_00955
  Exosomal proteins of bladder cancer cells
   CTRC953_00955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N VWA_3
Motif
Other DBs
NCBI-ProteinID: AGR97326
Position
202789..204312
Genome map
AA seq 507 aa AA seqDB search
MEEIKDFGPTLPACPPCIVVIFGATGDLTSRKLFPALYNLTKEGRLSENFVCVGFARRPK
SHEQFREEMKLAVQHFSHSSEIDIRVWESLENRIFYHQANFSDAEGYSALKAYLEQLDQQ
YGTQGNRLFYLSTPPDYFQEIIRNLNRHQLFYHEQGAQQPWSRLIIEKPFGVNLETAREL
QQCIDANIDEESVYRIDHYLGKETVQNILTIRFANTLFESCWNSQYIDHVQISVSESIGI
GSRGNFFEKSGMLRDMVQNHLTQLLCLLTMEPPSEFSSEEIKKEKIKILKKILPIREEDA
VRGQYGEGIVQDVSVLGYREEENVDPNSSVETYVALKLFIDNPRWKGVPFYLQAGKRLPK
RTTDIAVIFKKSSYNLFNAENCPLCPLENDLLIIRIQPDEGVALQFNCKVPGTNKLVRPV
KMDFRYDSYFNTVTPEAYERLLCDCILGDRTLFTSNEEVLASWELFSPLLEKWSQVHPIF
PNYMAGSLRPQEADELLSRDGKAWRPY
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
ttggaagaaattaaagactttggccccacattaccagcctgccctccctgtatcgtggtt
atttttggtgctacaggagacttgacctctaggaagctctttcctgctttatacaattta
acaaaggaaggacgtctatccgaaaactttgtttgtgttgggtttgctaggcgacctaag
tctcatgagcaatttcgcgaagaaatgaagcttgccgttcagcatttctctcactcatcg
gaaatagatattcgagtttgggaaagtctggaaaatagaatcttttaccaccaagctaat
ttttctgatgccgaaggctactctgctctgaaagcttatttggagcaactagatcaacaa
tatggaacacaagggaatcgtcttttttatttatcaacaccaccagattatttccaggaa
atcatccgcaatttaaatcggcatcagctattctatcatgaacaaggagcacaacagcct
tggtctcggctaattatagaaaagccttttggagttaatttagaaacagctcgagagctt
caacaatgcattgatgccaatattgatgaagagtcggtttatcgaatagaccattattta
ggaaaagaaacggttcaaaacattctgactattcgttttgctaatactctctttgagtct
tgctggaattctcagtacatagatcatgtgcaaatcagcgttagcgaatcaattggtata
ggatctcgagggaatttcttcgaaaagtcgggcatgctacgagacatggtacagaatcat
ttgacgcagctgctatgtctactgactatggaacctccttctgaattttcttccgaagaa
ataaaaaaagaaaaaattaaaattctaaagaaaattcttcctatccgcgaagaagatgct
gttcgtggccaatatggtgaagggattgtgcaagatgtttcagttctgggctatcgggag
gaagaaaatgtcgatccgaattcttcagtagaaacctacgttgcattaaaattatttatc
gacaatcctcgctggaaaggggttcccttttacttacaagcagggaaacgtcttcctaaa
agaacaacagatatcgctgtgatctttaaaaaatccagctacaatttattcaatgcagag
aattgtcctttgtgtccgttagaaaatgatttacttattattcgtattcaaccggatgaa
ggtgttgcgctacaatttaactgcaaggttccaggaacaaataagctcgtacgtcctgta
aaaatggacttccgttacgacagctattttaatactgttactcccgaagcttatgaacgg
ttactgtgcgactgtatccttggggacagaacgctattcactagcaatgaagaagtctta
gcatcttgggaactattttctcctctattagaaaaatggtctcaagtacaccctatattc
cctaactatatggccggatctttacgtcctcaagaagctgatgaactattatctagagat
ggaaaagcttggcggccctattaa

DBGET integrated database retrieval system