KEGG   Carboxydocella thermautotrophica: CFE_0476Help
Entry
CFE_0476          CDS       T05389                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cthm  Carboxydocella thermautotrophica
Pathway
cthm00260  Glycine, serine and threonine metabolism
cthm01100  Metabolic pathways
cthm01110  Biosynthesis of secondary metabolites
cthm01120  Microbial metabolism in diverse environments
cthm01130  Biosynthesis of antibiotics
cthm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cthm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CFE_0476
Enzymes [BR:cthm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CFE_0476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AVX19675
UniProt: A0A2R4MXU9
Position
478736..479776
Genome map
AA seq 346 aa AA seqDB search
MKYIDLRSDTVTQPTEEMRQAMARAEVGDDVYGEDPTVRRLEEKAAELFGKEAALLVPSG
TMGNQLAVLAHTQRGDEVIVEAEAHVFFYEVGGLGALAGVQTRTIRGEKGVLPAARVREA
IRLSDIHFPRTALICLENTHNRAGGTVMGLQEMEAIGQIGKEYQIPIHLDGARIFNAATY
LGLPVKVLTKDMDSVMFCLSKGLAAPIGSMLVGSAQFIARARRLRKMLGGGMRQAGIIAA
AGMVALETMVERLAEDHRRARQLAEGLAAIPGLKVDLERVQTNIVVADIMATGLSPAVFL
GKLKEQGVLAAAFGGNLVRFVTHKDIDDLDIDQALMEIERICRKGR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtacatagacttacgcagtgataccgtaacccagccgaccgaggagatgcggcaa
gccatggcccgggcggaagtgggggatgatgtttacggggaagatcccacggttcggcga
ttggaggaaaaagcggccgagctgtttggcaaagaggcggccctgctggtacccagcggg
actatgggcaaccagctggcggtgctggcccatacccagcggggagatgaggttatagta
gaggcagaagctcatgtctttttctatgaggtaggaggcctgggcgccctggccggagtc
cagacccgtaccatccgcggggaaaaaggggtgttgccggctgccagggtgcgggaggcc
attcgcctcagtgatattcattttccacgcacggccttgatctgcctggaaaatacccat
aaccgggcggggggaacagtaatggggcttcaggaaatggaggctattggccagattggc
aaggaatatcaaattcccattcatctggatggggccaggattttcaatgctgccacctac
cttggactgccggtaaaggtgctgaccaaggatatggattcggtgatgttttgcctctcc
aagggtctggcagctcctatcggttccatgctggtcgggtctgcccagttcattgcccgc
gcccggcgtttgcggaaaatgctgggcggtggtatgcgtcaggccgggataattgcggca
gctggaatggtggccctggagaccatggtggagcggctggcagaggaccaccggcgggcc
cgtcagctggcggagggattggctgccattcccgggctgaaggtggacttggaacgggta
caaactaatatcgtagtggctgatattatggcaacaggcttgagtccggcggttttcctg
ggcaaattgaaagaacagggggtactggccgcagcatttggcggcaatctggtgcggttt
gttacccataaagatatcgatgatctggatattgatcaggcactaatggaaatcgagagg
atttgccggaaagggagatag

DBGET integrated database retrieval system