KEGG   Chaetomium thermophilum: CTHT_0004120Help
Entry
CTHT_0004120      CDS       T03100                                 

Definition
(RefSeq) putative transcription factor involved in RNA polymerase II transcription regulation
  KO
K17498  transcription factor SPN1
Organism
cthr  Chaetomium thermophilum
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cthr03021]
    CTHT_0004120
Transcription machinery [BR:cthr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     CTHT_0004120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26 Vip3A_N ParE-like_toxin
Motif
Other DBs
NCBI-GeneID: 18254450
NCBI-ProteinID: XP_006690955
UniProt: G0RZT5
Position
Unknown
AA seq 437 aa AA seqDB search
MSEAIDHIEDDRRDTETPAAASNDDDAVNTAHSADGAADGHESDKDSDLLSEVDEEQFDD
YDPNLEERPVEIDENIAKSLKAAKRKKTDGQTTKKPKEGRRPKKRARPAEDDGGEVDARD
RRPRKARATGSERQKRDSSDEEEVNEENLTPEERRRRAIQRAVDDALKNPSKGKRKTGLD
LETEIDEQIANLKVAMEKACMADNEAREKGQAATHKLKLLPQVTAMLNRTSVQEYVLDPD
TNFLQSVKFFLEPLNDGSLPAYNIQRDIFNALTRLPITKEALLSSGIGKVVYFYTRSKRP
EPSIKRIAERLVGEWSRPILKRTDDYKKRQVETRDFDVTAAQLAQRQEAAVVGPQTLTLT
QRPAGKTRYELERERLLAPEVNPNRAQPPGLPASYTIAPRSTFDPSRAAAIAGHRPIGLA
GLDAFRKMTSKGKKNNR
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagccatcgaccatattgaggatgatcgccgcgataccgagacgcctgccgct
gcttcgaatgatgatgatgcagtcaatactgctcatagcgccgacggcgctgctgacggc
catgagtccgataaggattccgacctcctttccgaggtcgacgaagagcagttcgacgat
tacgatcccaatctcgaagagaggcccgtggaaattgatgaaaatattgccaaatcgttg
aaagccgccaagcgcaagaagaccgacggacaaacgacaaagaagccgaaggaagggcgt
aggccaaagaaacgcgcaagaccggccgaggatgatggcggcgaggttgacgcccgtgat
cgccgtcctcggaaagcgcgcgctactggcagcgagcggcagaaaagggattcatcagat
gaggaggaggtcaacgaagaaaacctcaccccagaggaacgccgccgtcgcgccatccaa
cgggccgtggatgatgcgctcaagaacccctcgaaggggaagcgcaaaactggtcttgac
ttggaaaccgagattgacgaacagatcgccaatctcaaggtcgcgatggagaaagcttgc
atggcagacaacgaagcccgcgaaaagggacaggctgccacccacaaactcaagcttctc
ccgcaagttaccgccatgcttaacaggacatcggtccaagaatacgtcctcgaccccgat
accaacttcctgcagtcagtcaagtttttcctcgaaccgctcaatgacggtagcctgccc
gcctacaacatccaacgcgacatcttcaatgcactcactcggcttcctattaccaaggaa
gctcttctgagcagcggcattggcaaagttgtctacttctacacgcgcagcaagcgcccg
gagcccagcatcaagcgcattgccgagcgcctggtgggtgaatggagccgtccgatcctg
aagaggacggatgactataagaaacggcaggtcgaaacccgcgatttcgacgttactgct
gcacaactcgcccagcgccaagaagccgcggtggttggcccacagacgctgaccttgaca
cagcggcccgcgggcaagactcgctacgaactcgagcgcgagcgcctgctcgctcccgag
gtcaaccccaaccgcgcccagccgcccggtctgcctgcaagctacacgatcgcgccgcgc
agcaccttcgacccgtcgcgtgcggctgcgattgcagggcaccgcccgatcggtcttgcg
ggcttagatgcattcaggaagatgacatctaaggggaagaagaacaatcgctga

DBGET integrated database retrieval system