KEGG   Chaetomium thermophilum: CTHT_0012240Help
Entry
CTHT_0012240      CDS       T03100                                 

Definition
(RefSeq) hypothetical protein
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
cthr  Chaetomium thermophilum
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cthr03016]
    CTHT_0012240
Enzymes [BR:cthr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     CTHT_0012240
Transfer RNA biogenesis [BR:cthr03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    CTHT_0012240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3
Motif
Other DBs
NCBI-GeneID: 18255262
NCBI-ProteinID: XP_006691741
UniProt: G0S139
Position
Unknown
AA seq 292 aa AA seqDB search
MKNLPTPGKVFISKKQKILSQLSLPDEQYTDASPKGSVDEGIRYLIDQINMQAGLVTTSS
CAGRVSVYLEGPKFGQGASSSDGEETAGNGDVAVEAGRENAVASSVGGKGGGEWLFVSHD
PVKNDAGESGYERLFGFGTVPAREQFVQDVFAPSTRLIHFKFEPMILHILTASLEHAQLV
IQAGMEAGFRESGAVSLLKKSGDDDANPMVAIRSMGLSFDSLIGAENDGIRRLIVSSEYL
KMLVRIANERFVENQKRIARFSAALESAFAPPKAKANWESAQARREQGVNFL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatctcccgacgcccggaaaagtatttatctccaaaaagcagaaaattctttct
cagctttcgttgccagatgagcagtacacagatgcctcacccaaaggctccgtcgacgaa
ggaatccgctatttgattgatcagatcaacatgcaagcagggcttgttacgacgagcagt
tgcgctggaagagtgagtgtgtatctggaggggccaaaatttggtcagggagcaagttcc
tccgacggtgaagagactgctggtaatggggatgtcgcagtcgaggctggccgtgaaaat
gccgttgccagttctgtgggaggaaaaggaggtggggagtggttgtttgtatcgcatgat
ccagtgaaaaatgatgctggggagagtggttatgagagactgttcggttttggaactgtg
cctgccagagagcagttcgtgcaagatgtcttcgcaccctcaacaagactgattcatttc
aagtttgagcctatgatcttacatatccttacagcgtctcttgagcatgcacagcttgtt
atccaagcaggcatggaagctggcttccgtgaaagtggagctgtaagcttgctgaagaag
tcgggagatgatgacgcaaacccgatggtggctatacggtccatgggattgtccttcgat
tcactgattggcgccgaaaacgatggtatccggcgtcttatcgtatcatctgagtacctg
aagatgctcgtccgaattgccaacgagcgatttgttgagaaccaaaagaggatagcgagg
ttcagcgctgcccttgaatctgcctttgcccccccaaaagctaaggcaaactgggaatct
gctcaggcgagaagggaacaaggggtgaacttcttgtag

DBGET integrated database retrieval system