KEGG   Chaetomium thermophilum: CTHT_0028430Help
Entry
CTHT_0028430      CDS       T03100                                 

Definition
(RefSeq) glycogen (starch) synthase-like protein
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
cthr  Chaetomium thermophilum
Pathway
cthr00500  Starch and sucrose metabolism
cthr01100  Metabolic pathways
Module
cthr_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CTHT_0028430
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cthr01003]
    CTHT_0028430
Enzymes [BR:cthr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CTHT_0028430
Glycosyltransferases [BR:cthr01003]
 Polysaccharide
  Storage polysaccharide
   CTHT_0028430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 18256881
NCBI-ProteinID: XP_006693299
UniProt: G0S7Q3
Position
Unknown
AA seq 705 aa AA seqDB search
MASGESEREGRDVRNHILFEISTEVAHRVGGIYSVIKSKAPVTTAEYGDRYTLLGPLNHQ
SAAVEVETIEPTVPELAETIQAMRDRGIGIVYGRWLVEGAPRVLLFDTKTAYNYLNEWKA
DLWNVASIPSPDNDEETNEAIVFGYLVAWFLGELQFVCHEKKRAVIAHFHEWLAGVALPL
IRKRAIDVTTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDAEAGKRGIYHRYCIERAAAH
TCDVFTTVSHITAYESEHLLKRKPDGVLPNGLNVTKFAAVHEFQNLHQKSKEKIHDFVRG
HFYGHYDFDPENTLYFFTAGRYEFRNKGVDMFIESLARLNHRLKTSNSKMTVVAFIIMPA
QTHSLTVEALKGQAVIKSLRDTVDTIEKNIGRRIFERSLKWKEGDPMPDDKELLSSQDRV
LLRRRLFAMKRHGLPPIVTHNMVNDHDDPILNQIRRVQLFNHPSDRVKVIFHPEFLNSSS
PILPLDYDDFVRGTHLGVFASYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSS
DYGIYIVDRRTKGVEDSVNQLTQYMFEFTQKSRRQRINQRNRTERLSDLLDWKRMGLEYV
KARQLALRRAYPNSFVGDEEEDFIPGVEQKISRPFSVPGSPRDRTGMMTPGDFASLQEGR
EGLNTEDYVAWKLPEEEDPYEYPFPLTLRTKRAGGSPNGSSHNGN
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcggagagtcagaacgcgaaggtcgcgacgtgcggaatcacatcctctttgag
atctccaccgaggtcgcccatcgagttggtggcatttactcagtcatcaaatccaaggcg
ccagtgaccacagcagagtatggcgaccgctacaccctccttggtcccctcaaccaccag
tcggcggctgttgaggtcgagaccattgagccgaccgtcccggagcttgctgagaccatc
caagcgatgagggatcgcggcattggcatagtctatggccgttggctggttgagggcgca
ccaagagtgctccttttcgacaccaagactgcctacaattacctgaacgagtggaaggcc
gatctctggaacgttgcttccatcccttctcccgacaacgacgaggaaactaatgaggcc
atcgtcttcggttatctcgttgcttggttccttggagagctgcagttcgtctgccatgag
aagaagagggcagtcattgcgcacttccacgagtggcttgccggtgttgcgctgcctctg
atcaggaagcgtgccattgatgtgaccaccatcttcacaactcatgcaacactgctgggt
cggtatctgtgcgccggctctgtcgacttctacaacaacctgcaatacttcgacgttgat
gctgaggccggcaagcgcggtatctaccacaggtactgcatcgagagggcggcggcccac
acgtgtgacgtcttcaccaccgtctcccacatcactgcctatgaaagcgagcacctgctc
aagcgcaagcctgacggtgtcttgcctaacgggctgaatgtcaccaaatttgccgctgtc
cacgagttccagaacctgcaccagaagtccaaggagaagatccacgacttcgttcgcggc
cacttctacggccactacgacttcgatccagagaacacgctctacttcttcacggcaggc
cgctatgagttccgcaataagggtgtcgacatgttcattgagtcccttgctcgcctaaat
caccggctcaagacctccaacagcaagatgaccgttgttgctttcatcatcatgcccgct
cagacacactcgctgacggtcgaggctctgaagggccaggctgtcatcaagtcccttcgg
gatactgtggacacaattgagaagaatatcggtcgtcgcatcttcgagcggtccctgaag
tggaaggagggcgatcccatgccggatgataaggaacttctctcgagccaggatcgtgtg
ctgctgcgcaggcgtctgttcgccatgaagaggcacgggctgccgccaattgtcacacac
aacatggttaatgaccatgacgacccgatcctgaaccagatccgcagagtacagctgttc
aaccatcccagcgaccgcgtcaaggttatcttccatcccgagttcctgaactcgtccagc
ccgatcctgccgctcgattatgacgactttgtccgcggtactcacctcggcgtcttcgcg
tcctactatgagccgtggggctacacaccggctgaatgcactgtcatgggtgttcccagc
atcaccaccaacctttctggtttcggctgctacatggaagagctgatcgagaattcgagc
gactatggcatctacatcgtcgatcgtcgtaccaagggtgtcgaagattcggtcaatcag
cttacccagtacatgtttgagttcacgcagaagagccgccgtcagcgcatcaaccagcgc
aaccggactgagcgtctgagtgaccttcttgactggaagcgcatgggtctcgagtacgtc
aaagctcgtcagctggccctcaggagggcttatccgaactcgttcgttggtgacgaggag
gaggacttcatcccgggtgtcgagcagaagatctcgcggccattctcggtgcctggctct
cctagggataggaccggcatgatgacccccggtgactttgccagtctccaggagggtcgt
gagggcctgaacaccgaggattatgttgcttggaagctccctgaggaagaagacccctat
gagtacccgttcccgctcacgctacggacgaagcgtgctggtgggagccccaacggcagc
agccacaacggaaactaa

DBGET integrated database retrieval system