KEGG   Chaetomium thermophilum: CTHT_0035640Help
Entry
CTHT_0035640      CDS       T03100                                 

Definition
(RefSeq) putative pre-mRNA splicing factor
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
cthr  Chaetomium thermophilum
Pathway
cthr03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CTHT_0035640
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cthr03041]
    CTHT_0035640
Enzymes [BR:cthr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     CTHT_0035640
Spliceosome [BR:cthr03041]
 Complex C
  Other components
   Step II factors
    CTHT_0035640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 AAA_30 T2SSE AAA_19 DUF2075 AAA_14 AAA_7 SRP54 PhoH AAA_33 ATPase AAA_23 AAA_16
Motif
Other DBs
NCBI-GeneID: 18257602
NCBI-ProteinID: XP_006693994
UniProt: G0S700
Structure
PDB: 

Position
Unknown
AA seq 1222 aa AA seqDB search
MRRREQQQLHLHSEARSRAGFLPLTSSPCCCADQPQQLADKMDDLESLELLSLVSKVTSE
LQNHLGINEKTLAEFVIAQRLECATFEDFKAKLAAVGADFPPSLMESIDRLVRTMHPKFK
GKQNGDQREDREEKPPKSLEEKAAIFKGLAIPDREIEPADDIDDTLALLESLEPKRADKD
RPSRKRSRSPEDYDGSYRSRKDRYRSRSRSPARFRSRSLSRSRSKSPRRGRRKSSRYDED
DTFRRPPPRDLDDAPQLYKIYDGHVTGIKDFGAFVNLHGVKGKIDGLVHISAFGQRVNHP
SDAVSMGQNVKVKVIKIEGNRIGLSMKDVDQETGMDLAPQMRIGSGANMEALGGSRRGIG
GSDGAANGPPLSGATRPQKKRLTSPERWEIRQMIAAGIAKASDYPDLEEEYNATLRGEGQ
MELEEDIDIEIRDEEPPFLAGQTKQSLELSPIRVVKAPDGSLNRAAMTGAQLARERREAR
QQEAEEQQEKAKVDLSSQWQDPMANPEHRQFASDLRKRAQAQTSSDSVPEWKRAIAPKNQ
SFGPRTNMSIKEQRESLPVFQFRDQIIQAVKDNQILIVVGETGSGKTTQVTQYLAEAGFT
KYGMIGCTQPRRVAAVSVAKRVAEEVGCQLGQEVGYTIRFEDVTSPATKIKYMTDGMLQR
EILMDPDLKRYSVIMLDEAHERTIATDVLFALLKKTVKRRPDLKVIVTSATLDAEKFSEY
FNSCPIFTIPGRTFPVEILYSREPEPDYLEAALTTVMQIHLTEPPGDILVFLTGQEEIDT
ACEILYERMKALGPSVPELIILPIYSALPSEMQSRIFEPAPPGSRKVVIATNIAETSITI
DYIYYVVDPGFVKQNAYDPKLGMDSLVVTPISQAQANQRAGRAGRTGPGKCFRLYTEAAY
QSEMLPTTIPDIQRQNLANTILLLKAMGINDLLRFDFMDPPPVNTMLTALEELYALGALD
DEGLLTRLGRKMADFPMEPSLSKVLIASVDKGCSDEMVTIVSMLNLQQIFYRPKDKQQQA
DQKKAKFHDPTGDHLTLLNVYNAWKNSGYSNAWCFENYIQARAMRRARDVRQQIVKIMER
HRHPIISCGRDTDKIRQALCAGFFRNTARKDPQEGYKTLTEGTPVYLHPSSALFGKQAEW
VLYHELVLTTKEYMHFTTAIEPKWLVEAAPTFFKLAPTDRLSKRKKAERIQPLYNKYEGE
DGWRLSAQRRAARPGGGGGTWG
NT seq 3669 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagacgagagcagcaacagctgcatttacactctgaagcgcgctccagggccggc
tttttgccactaacctcatcgccttgctgctgtgcagaccagccgcagcaactggccgac
aaaatggacgacctagagtcgcttgagctactttccctcgtgtcgaaagtcacgtcagaa
ttacagaatcacttagggattaacgaaaagacactggccgagtttgttatcgcccagcgt
ctggaatgtgcgaccttcgaggacttcaaggccaagctggccgccgtcggcgccgacttt
ccgcccagcttgatggaaagcattgatcgcctcgtccggacgatgcaccctaaattcaaa
gggaagcagaatggtgaccaaagggaagaccgtgaagagaaacctcccaagtctttggaa
gagaaagcggcgattttcaaggggcttgccattcccgaccgggagatcgaacccgccgac
gacatcgatgatactcttgctctgctcgagagcctggagccgaagcgcgcagataaggac
cgtccatcgagaaagcgcagccggagcccagaggattacgatggctcgtatcggagccga
aaggacagataccgctcacggtcgaggtcaccggcaaggttccgctcacggtcactgtca
agatccaggtctaaatcgccacgacgaggtcgtcgtaagagcagccgatacgatgaagat
gatacgtttcgtcgcccaccgccacgggatttggacgatgccccacagctgtacaaaatc
tatgatggccatgtcacaggtatcaaagactttggcgctttcgttaacttgcatggagtg
aagggtaaaatcgatggtttagtgcacatttcggcgtttgggcagcgagtgaaccatcca
tcggacgccgtgtcaatgggccagaacgtcaaagtgaaggtcatcaagattgagggcaac
cgcatcggactgtcgatgaaagatgtcgatcaagaaactggaatggaccttgcaccgcag
atgaggataggctccggcgccaatatggaggccttaggaggctccaggagaggcataggt
ggctctgatggtgcggcaaacgggccgcctctatctggagcaacaagaccgcaaaagaag
aggttaacgtctcctgaaagatgggagatccggcagatgatcgccgcggggattgcgaag
gcgtcagattatccggacctcgaagaagagtacaatgccactctcaggggcgaaggtcag
atggagctggaggaagacattgacattgagatccgggatgaggagcctccgtttctcgct
ggacagacaaagcagtcgctcgagctgtcgcccatccgagtggtcaaagcccccgatggc
tccctcaatcgtgcggccatgaccggtgcccaacttgcgagagagcgtagagaggctcgc
caacaggaggccgaggaacagcaagagaaggctaaggttgacctgtcatctcaatggcag
gatcccatggccaatcccgagcatcgccaatttgccagtgatttacgcaagcgcgcacaa
gcccaaacctcttctgattctgtccctgaatggaaacgagccattgcaccaaagaatcag
tcgtttggccctcgaaccaacatgtccatcaaggaacagcgggaatccttgcctgtgttt
cagttccgagatcaaatcattcaagctgttaaggacaaccagattctcatcgtggttggt
gagacgggttctggcaagacgactcaagtcacgcagtaccttgcagaggccggtttcacc
aaatatggcatgattggatgcacgcaacctcggcgtgtcgccgccgtttcggtcgccaag
cgtgtggctgaagaagttggctgtcagctaggccaagaggttggctataccatcagattc
gaagatgttactagtccggcgaccaagatcaagtacatgacggacggaatgttacaacgt
gaaattctgatggaccctgatctcaagcgttactcggtcatcatgttagacgaggcccac
gagcggacaattgcaaccgatgtgctattcgcgctgctcaagaagacggttaagcggcgg
ccggaccttaaggtcattgtcaccagtgctacccttgacgcagagaagttcagcgagtac
tttaactcgtgtcctattttcaccattcctggccgaacgttccccgtggagattctctac
tctcgagaaccggaaccggattacctcgaggcagctctgactacggtaatgcagatccac
ttgacggaacccccaggagatatcctagttttcttgaccggccaagaagaaattgataca
gcctgcgagatcctatatgagcgaatgaaggcattggggcctagcgtcccagagctcatc
atactgccgatttactctgcgctgcccagcgagatgcaaagccgaatctttgagccagca
cctcctggcagtcgtaaagtggtcattgccacaaacatcgctgaaacatccatcacgatc
gactacatctattacgttgttgatcccggcttcgtgaagcagaacgcctatgatccaaag
ttgggaatggattctcttgtggtcacccctatttcccaggctcaagccaaccaacgtgct
ggacgagccggtcgtacaggtccgggcaagtgctttcggttgtatacggaggctgcatac
caatcagaaatgcttccaacgactatcccagacatccaacgacaaaatctagccaatacg
atcctgttacttaaggccatgggtatcaacgaccttcttcgttttgactttatggatcct
ccgcccgtcaacacaatgcttactgcactcgaagaactttatgcactgggcgctttggac
gatgaaggcctgctgactcgcctgggaaggaagatggccgacttccccatggagccctct
ctgtcgaaggtcttgatcgcctctgtcgacaagggctgttcggacgaaatggtgacaatt
gtttccatgctcaacctacagcagattttctaccgaccaaaggataagcagcagcaagcc
gaccagaagaaggccaagttccatgatccgacgggagaccatcttacccttctcaacgtc
tacaatgcctggaaaaatagcggttactccaacgcctggtgttttgagaactacatccag
gcgcgggccatgcgtcgtgctcgggatgtacggcagcagatcgtcaagatcatggaacgc
caccgtcatcccatcatcagctgcgggcgtgacaccgacaagatccggcaagcgctctgc
gctggcttcttccgtaatacggcacgcaaggacccgcaagagggctacaagacactgacc
gagggcacgccggtgtacctacaccccagctcggcgctttttggaaagcaagccgagtgg
gtgctttaccacgagctggtactgacaactaaagagtatatgcattttacgacggccatt
gagcccaagtggctcgtggaagccgctccaacattctttaagctcgcgccgacggacagg
ttgtcgaagaggaagaaggccgagaggatccagcccttgtacaacaagtacgagggtgaa
gatggctggcgtctcagcgctcaacggagggctgcacggccgggtggtggtggcggtacc
tggggctaa

DBGET integrated database retrieval system