KEGG   Chaetomium thermophilum: CTHT_0036610Help
Entry
CTHT_0036610      CDS       T03100                                 

Definition
(RefSeq) hypothetical protein
  KO
K07760  cyclin-dependent kinase [EC:2.7.11.22]
Organism
cthr  Chaetomium thermophilum
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cthr01001]
    CTHT_0036610
Enzymes [BR:cthr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     CTHT_0036610
Protein kinases [BR:cthr01001]
 Serine/threonine kinases: CMGC group
  CDK family
   CTHT_0036610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal KIX
Motif
Other DBs
NCBI-GeneID: 18257699
NCBI-ProteinID: XP_006694089
UniProt: G0S7K2
Position
Unknown
AA seq 390 aa AA seqDB search
MTASDWRSSLTAAERYDNIYRLTKSGVAARLGKSAYNIENEAYKTCKTRDEYDEICNPPG
DAEAPLADLDNVGLEGGEPKTIGSYSDCRYVAGGVTAEVYRSKSNALKVIVETRDMKPHN
PRREAKILESLRGGPGVIPLLEVFHDQNQRLVLVFPFMPVSLAHVMEKVTAPLPDPFLRH
VFTEFFKGLDFIHSQGIIHRDIKPSAILIESTKAFTTKPHVYISDFGTAWHPEFSSSDEP
ADEKILDVGTSQYRAPEALFGHKSYTTALDLWAAGIVLAECIKPSHKPIFESRPAHEDGS
QLGLILSIFKTLGSPTKENWPEAENFKTPPFEFYRSFEGVEGGWEGILPTVRKEWRELVK
ALVKYESAWRVTARQALDFPCLKGPEVEDS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgtcggactggcgaagttcactcacggcagcagagcgctatgacaacatttac
aggctcaccaagtcgggagttgcggcccgcttggggaagagtgcctacaacatcgagaac
gaggcgtacaagacgtgcaagactagggacgagtacgatgaaatctgcaatccgccgggg
gacgcagaagccccgttagcggatctggacaatgttgggctagagggtggtgagcccaag
acgattggcagctactcagactgccgctatgtggctggcggtgtgactgccgaagtctac
cgttccaagtctaacgctctgaaggtcatcgtggagactcgggatatgaagccgcacaac
ccgcgacgggaggccaagatccttgagtcgcttcgcggcggccctggagtcattcccctt
ttggaggtcttccacgaccagaaccaacggctggtgcttgtgttccccttcatgcctgtg
agcctggcgcatgtgatggaaaaggtcacagcaccgctaccagatcccttcctccgccac
gtcttcacagagttcttcaaaggcctcgacttcatccactctcagggcatcattcaccgc
gacattaagccatctgccatcctaatcgagtccaccaaagcctttaccaccaaaccccac
gtctacatctctgatttcggcacagcctggcatcccgaattttcttcctcagacgaacca
gcggatgagaagattctcgacgtcggcacgtcccaataccgcgctccagaagccctcttt
ggccacaagtcctacacgactgcgctggacctttgggcagccggtattgttctggctgag
tgcattaaaccaagccacaagccgatttttgagtcccggccagctcacgaggatggtagc
cagctcggtctgatcctgagcatttttaagacactcgggtcgccgactaaggagaactgg
cctgaggcggagaacttcaagaccccgccgttcgagttttataggtcgttcgagggggtt
gagggtggatgggaaggcatcctacctactgtgaggaaagaatggagggagctggtgaag
gctctggtgaagtatgagagtgcttggagagttactgctcgccaggcgcttgacttcccc
tgcttgaaaggtcctgaggttgaggactcttaa

DBGET integrated database retrieval system