KEGG   Chaetomium thermophilum: CTHT_0041190
Entry
CTHT_0041190      CDS       T03100                                 

Definition
(RefSeq) nitrite reductase-like protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
cthr  Chaetomium thermophilum
Pathway
cthr00910  Nitrogen metabolism
cthr01100  Metabolic pathways
Module
cthr_M00531  Assimilatory nitrate reduction, nitrate => ammonia
cthr_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    CTHT_0041190
Enzymes [BR:cthr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     CTHT_0041190
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Rieske_2 Fer2_BFD NIR_SIR_ferr Rieske Rubredoxin_C Pyr_redox_3 K_oxygenase
Other DBs
NCBI-GeneID: 18258157
NCBI-ProteinID: XP_006694525
UniProt: G0SA68
Position
Unknown
AA seq 1177 aa
MAVMPQSQKTIVVVGLGMVGISFIEKLLKLDVRTRQYNIIVFGEEPHVAYNRVGLTTFFE
HRKVENLYLNPAEWYTSIPDNALTYHISTPVTAINPISKTITTSTGTTVPYDILVLATGS
NAALPRNTPGIDARGVFVYRTVADLEALITHSQQLLPSQDQEKVGAVVGGGLLGLEAAKA
LLDLQTYDRVVVVERNGWVLARQLDGDAGALVVEKVRQLGVEVLLEKRVACVETDEGINV
TGLRFEDGTALRCQTVVFATGIRPRDELARTAGLAVSESGGIVVDSQLRTSTRDVYAIGE
CASWEGQTFGLIAPGVEMADVLAWNLTQAAEHGGQERSFSQPDLSTKLKLLGVEVASFGD
YFADRDGPRRLPEQRGRKKGETGTTCNNTKVKALTYRDPFQHIYKKYIFTSDGKYLLGGM
MIGDTQDYVKLVPLAKNLKPLDTPPAELILGSSSKKDSDGTDDLPDDTQVCSCHNVTKGA
IVSAVRDGTATTLSTLKSCTKAGTGCGGCMPLVTTIFNKTMASLGNAVSNHICAHIPRSR
AELYHIVMVKQLKTFAEVMTAAGTDPQSMGCEICKPAVGSILSSLWNGHVMSRPLHGLQD
TNDRFLANIQRDGSFSVVPRVPGGEITPEKLIVLGEVAREYGLYTKITGGQRIDLFGARK
QDLPAIWKKLVDAGMESGHAYAKALRTVKSCVGSTWCRYGIGDSVGMAIRLEERYKSIRA
PHKIKGGVSGCVRECAEAQSKDFGLIATDKGFNIYVGGNGGAKPRHAELLAKDVPPTEVI
PILDRYLMFYIRTADRLQRTARWIESLPGGINYLRDVVLKDSLGLAAELESQMQDLVDSY
FDEWAEAVKDPELAAKFAQFSNAKDGQDTVEREDERGQKRPAWWPKQAVTTTTTTIAVSQ
SDAARGEEARSSVSDSSSDSATLKSSSSSDSLSSATTVSTSPPPSSDSLEPPNQIPFSSL
RTHWSSTTWMPLIPASHFDGADDLPNGISATIRVSDTQLAIFRVRGRYYATQQMCPHKRA
FVLSDSLVGTNPPSEEKQEGEVYIACPHHKTPFSLPTGACLTSTGNNPNESMSIATFDVE
EREDGMVYVKLPPLDELDAALGTSRWIVRRGETGAAQLEEMDQKFGGFGDGRWKRPAAVV
RGRARKPELRQKKEKDEKGVEMIVEGGCGGCGGTPDW
NT seq 3534 nt   +upstreamnt  +downstreamnt
atggccgtgatgccccaaagccaaaagacgatcgttgttgtcggcctgggaatggtcggc
atcagcttcatagaaaaactcctgaagctcgacgttcgcacacgccagtacaacattatc
gtctttggcgaagaaccgcacgtagcatacaaccgcgtcggcctaaccaccttcttcgag
caccgtaaggtcgagaacctgtatctcaaccccgcggaatggtacacctccatccccgat
aacgccctcacataccacatttctacacctgtaacagccatcaatccaatttccaaaaca
ataactacttcaaccggcaccaccgtaccatatgacatcctggttctagcaaccggctca
aacgcggccctgccccgtaacacccctggcattgacgcccgcggggtttttgtctaccgt
acggtcgccgatcttgaggccctcatcacacactcccagcaacttctcccctcacaggat
caggaaaaggtcggtgcggtagtaggaggcggactcctcggcctcgaagccgcgaaagcc
ctactcgacctacaaacgtatgaccgcgtcgtcgttgttgagcgtaatggctgggtgctc
gcacgtcagctggacggggatgcgggcgctctagtggtcgagaaggtccggcagttgggg
gttgaggtattgttagagaagagggtagcttgtgttgagacagatgagggaattaacgtg
acgggattgagattcgaagatggaacggcactaaggtgtcaaactgtggtgtttgcgact
ggaatcaggccgagggatgagcttgcgagaacggctgggcttgctgttagcgagtccggg
gggattgtggtcgactcgcagttaaggacgagtacccgagatgtgtatgctattggggag
tgtgctagctgggagggacagacgtttgggttgatcgcccctggtgttgagatggcggat
gtgttggcatggaacctgacacaagctgctgagcatggtgggcaggagagatccttcagc
cagccagacttaagcaccaaactcaagcttttgggtgtcgaggttgccagcttcggggat
tacttcgccgaccgcgatggaccaaggaggctgcccgagcaaaggggacgcaaaaagggg
gagaccgggacaacatgcaacaacaccaaagtcaaagccctaacctaccgcgaccccttc
cagcacatctacaaaaagtacatcttcacctctgatggcaagtacctcctcggcggcatg
atgatcggtgacacgcaggactacgtcaagctagtccccctagccaaaaacctcaaaccc
ctagacaccccgccagccgaactcatcctaggcagctccagcaagaaggactcagacggt
acagacgacctccccgacgacacccaagtctgcagctgccacaacgtaaccaaaggcgcc
atcgtctctgccgtgcgcgacggcacagcaacgaccctctcgaccctcaaatcctgcacc
aaagccggcaccggctgcggcgggtgcatgccgctcgtcacaaccatcttcaacaagacc
atggcctctctgggcaacgcggtgtctaatcacatctgcgcacacatcccacgctcgcgc
gccgagctctaccacatcgtcatggtcaagcagctcaagaccttcgccgaagtgatgacc
gccgcgggaacagaccctcagagcatgggttgcgagatctgcaagccggcggtgggcagc
atcctgtccagcttgtggaacggacatgtaatgtcgcgtccgctgcacgggttgcaggac
acgaacgaccggtttttggccaacattcagagggatggcagtttcagcgttgtgccgcgc
gtgcctggaggggaaataacaccagagaagttgatcgtcctgggcgaggtggcgcgcgag
tacgggctgtataccaagatcacgggcgggcaacggattgatctttttggggcccgcaag
caggacttaccggcgatttggaagaagttggtcgatgcgggcatggagagtgggcatgcg
tatgccaaggcgttgaggacggtgaaaagctgtgtagggtcgacgtggtgtcggtatggg
attggtgatagcgtgggcatggcgataaggctagaggagaggtataagagtattagggcg
ccgcataagattaagggaggcgtgagtgggtgtgtgagagagtgtgcggaggctcagagc
aaagacttcggcctcatcgccacagacaaaggtttcaatatctacgtcggagggaacggc
ggtgccaagcctcgtcatgccgaactcctggcgaaggatgttcctccaacagaggtcatt
cctatccttgaccggtacctcatgttctacattcggactgccgatagactccaacgcacg
gcacgctggatcgagtctcttcctggcgggatcaactacctccgtgatgttgtgctgaag
gattccttaggcctggcagccgagctcgagtcgcagatgcaggacttggtcgactcatac
tttgatgagtgggcagaagccgtcaaggatccagagctcgcggctaagttcgctcagttt
tcgaacgccaaagatggacaagacactgtggagagggaagacgagcgagggcagaagagg
ccggcgtggtggccgaagcaagcagtcaccactacaacgactactattgcagtgtctcaa
tccgacgcggcacgtggcgaagaagcacgctcgtcagtctcagattcgtcatccgactcg
gcaaccctcaaatcttcgtcctcatcggactccctctcctctgcaacgacagtatctacc
tctccccctccctcatcagactcactcgagccccctaatcaaatccccttttcatcactc
cgcacccactggtcctcaacaacatggatgcccctcatcccggcctcacactttgacggc
gccgacgaccttcccaacggcatcagcgcgacaatccgggtctctgatactcaacttgcc
atctttcgcgtccgtggtcgctactacgcgacccagcagatgtgccctcataaacgggcc
tttgtgctttccgactcacttgtcggaaccaaccctccttccgaggagaagcaagaaggg
gaggtatacatcgcctgccctcaccataagactccgttctctcttcccacaggggcatgt
ctcacctcaacgggcaataaccctaacgagagcatgtctatcgcaacgttcgatgtggaa
gagcgcgaagatggtatggtgtatgtcaaactaccaccgctagacgagctagatgctgcg
cttggaacatcgcgatggatcgttcgcagaggggagactggcgccgcacagcttgaagag
atggaccagaagtttggagggtttggagacggtcgatggaagaggcctgcagctgtggtg
agaggaagggccaggaagccagaattgagacagaagaaagagaaggatgagaaaggcgtc
gaaatgatagtagaaggaggttgtgggggatgtgggggaactccagattggtag

DBGET integrated database retrieval system