KEGG   Chaetomium thermophilum: CTHT_0060860Help
Entry
CTHT_0060860      CDS       T03100                                 

Definition
(RefSeq) putative transcription elongation factor
  KO
K03145  transcription elongation factor S-II
Organism
cthr  Chaetomium thermophilum
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cthr03021]
    CTHT_0060860
Transcription machinery [BR:cthr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription elongation factors
     CTHT_0060860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_M TFIIS_C Med26 SH3BGR Adaptin_binding
Motif
Other DBs
NCBI-GeneID: 18260124
NCBI-ProteinID: XP_006696402
UniProt: G0SF55
Position
Unknown
AA seq 303 aa AA seqDB search
MDDQELTRRIRLLTKAVASEPASVVIEILEELKKEKAPTEEQLRVGAPSTKAGVAVGKLR
SHQDKNIARIAGEIVSKWRKNVDAAKDAKKRKLEQQQQQQTNTPTPKDSPAPPSSAYNTP
YQGDPEKRHFKVDNVDISRTGNKVRDGCIGVLYNGLAYRRTESIEEILQKAMEVEAAAFE
VYKGDTPEYRSKIRGLMTSLKRKDNAELGDRVMKGEITPHQFVKMTEKELASEAQRLRDA
QLERENMLKAQVPMAQKSISDSLQCSKCKQKKVSYSQAQTRSADEPMTTFCECTVCGHRW
KFS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggatgaccaagaacttacccggcgcatccggctgcttaccaaggccgtcgcttctgag
ccggcctcagtcgtcatcgagatccttgaggagttgaagaaggagaaggctccgactgag
gagcagcttcgcgtaggtgctccatccactaaggcgggcgtcgccgtcggcaagttgcgt
tcgcatcaagataagaacattgcccgcattgccggcgagattgtctccaagtggcgcaag
aacgtcgatgctgccaaggatgcgaagaagcgcaagcttgagcagcagcagcagcaacag
acgaacactccgactcccaaggactcacccgctcctccctcatccgcctacaacaccccg
taccagggcgatcccgagaagcgtcacttcaaggttgacaacgttgatatctcgcgtact
ggtaataaggttcgggatggttgcattggcgtgctgtacaacggcctggcataccggcgc
accgagtcgattgaggagatccttcagaaggccatggaagtcgaggcggccgcgttcgag
gtgtataagggcgacactcctgagtaccggagcaagatacgtggtctgatgaccagtctc
aagcgtaaggacaacgccgagctgggcgaccgcgtcatgaagggcgagattaccccgcac
cagttcgtgaaaatgacagagaaggagctcgcgtcggaggcccaacgtctgcgcgatgcc
caactcgagcgtgagaacatgctcaaggcacaagtgccgatggcgcagaagtctattagc
gactcgctccagtgctcgaagtgcaagcagaagaaggtgtcctacagccaggctcagacc
cgctctgctgatgaaccgatgacaaccttttgtgagtgtactgtttgcggccaccgctgg
aagttctcgtaa

DBGET integrated database retrieval system