KEGG   Chaetomium thermophilum: CTHT_0071960
Entry
CTHT_0071960      CDS       T03100                                 

Definition
(RefSeq) bifunctional enzyme with both catalase and broad- spectrum peroxidase activity-like protein
  KO
K03782  catalase-peroxidase [EC:1.11.1.21]
Organism
cthr  Chaetomium thermophilum
Pathway
cthr00360  Phenylalanine metabolism
cthr00380  Tryptophan metabolism
cthr01100  Metabolic pathways
cthr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    CTHT_0071960
   00380 Tryptophan metabolism
    CTHT_0071960
Enzymes [BR:cthr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.21  catalase-peroxidase
     CTHT_0071960
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 18261234
NCBI-ProteinID: XP_006697459
UniProt: G0SFS6
Position
Unknown
AA seq 723 aa
MGECPVRHDNVAGGGTRNTDWWPKQLRLNILRQHQPASNPYPKDFDYAAAFKSLDYEALK
QDIKAVLTDSQDWWPADFGHYGGLFIRMAWHSAGTYRVFDGRGGGGQGQQRFAPLNSWPD
NVSLDKARRLLWPVKQKYGDKISWADLMLLAGNVALESMGLKTFGFAGGRPDTWEADESA
YWGGETTWLGNEVRYANKDIKNRELETPLAAAHMGLIYVNPEGPDGNPDPVAAARDIRIT
FGRMAMNDEETVALIAGGHTFGKTHGAGPTDNVGKEPEAAPIEEQGFGWSNKFGSGKGPD
TITSGLEVIWTKTPTQWSTNFLEYLFKFDWELTKSPAGANQWVAKNAEAFIPDPYDPSKK
HPPRMLTTDLALRFDPVYEKISRRFLEHPDEFADAFARAWFKLLHRDMGPRTRWLGPEIP
SEILPWEDYIPPVDYPVIDDADVAALKQTILATGIAPHKLISTAWASASTFRGSDKRGGA
NGARIRLAPQKDWPVNNPAQLAEVLSALEAVQAQFNSTAPGGKKVSLADLIVLGGVAALE
QAAGVPVPFTPGRNDTTQEYTEVESFSYLEPVADGFRNYGRGTDRVRTEQLLVDRAHLLT
LTPPEMTVLVGGLRVLGANWDGSTHGVFTKRPGQLTNDFFVNLLDMSTAWRSIDGEIFEG
YDRKTGEKKWTATRVDLIFGSHAELRAIAEVYASADGQEKFVRDFIAAWDKVMNLDRFDL
GKR
NT seq 2172 nt   +upstreamnt  +downstreamnt
atgggtgaatgccccgttcgtcatgacaatgtcgccggtggcggcaccaggaacaccgac
tggtggcccaagcagctccggctcaacatcctccgccagcatcagcctgcctcgaaccca
taccccaaggacttcgattatgctgctgccttcaagtctctggactacgaggctctgaag
caggatatcaaggcggtgttgacagattctcaggattggtggccggctgactttggccac
tatggcggtctcttcatccgtatggcctggcacagcgctggcacctatcgtgtctttgat
ggacgcggtggcggtggccagggtcagcagcgcttcgctcctctcaacagttggccggac
aacgtcagcctggacaaagctcggcgtctcctctggcccgtgaagcagaagtatggcgac
aagatctcatgggccgacttgatgcttttggcgggtaatgtggcactcgagtcaatgggc
ctgaagacgttcggctttgctggcggtcgccctgacacctgggaagctgatgaatcggca
tactggggcggcgagacgacttggctgggtaatgaagttcgctatgccaacaaggacatc
aagaaccgcgagctcgaaactcccttggctgctgcccacatgggtctgatctacgtcaac
ccagagggacccgacggcaaccccgatccggtggccgctgctcgggatatccgcatcact
ttcggtcgtatggcaatgaacgacgaggagacagtggccctcattgcgggtggccacact
tttggcaagacacatggcgcaggccctactgacaatgttggcaaggagcccgaggctgct
cccatcgaggagcaaggttttggctggagcaataagtttggctctggcaagggtcctgac
accatcaccagtggtctcgaggtcatttggaccaagactccgacccaatggagtaccaat
ttcctggagtacctcttcaagtttgactgggagctcaccaagagccctgctggtgccaac
cagtgggtagctaagaatgctgaggccttcattcccgacccctatgacccctccaagaag
cacccgccgcgtatgctcacgaccgatctggcgctgcgcttcgaccccgtctatgagaag
atttctcgtcgcttcctcgaacatcccgacgagttcgccgatgccttcgcccgcgcctgg
ttcaagctgctgcaccgcgacatgggcccgcgtactcgctggctcggtcccgagatcccg
tctgagatcttgccttgggaggactacatcccgccggttgactatcctgtcatcgacgac
gcagatgtcgctgccctcaagcaaacaattcttgctaccggcattgccccccacaagctc
atttccacagcttgggcgtcggcatcgaccttccgtggcagcgacaagcgcggtggtgcc
aatggtgctcgcattcgtctcgctccgcagaaggactggccggtcaacaacccggctcaa
ctagctgaggtgctgtcggccctggaggctgtccaggctcagttcaactccacagcccct
ggtggtaagaaggtgtcgctggctgatctaatcgtccttggcggcgttgccgccctggaa
caggctgccggtgtgcctgtgcccttcactcctggccgcaacgatacgacacaggagtat
accgaggtcgagtccttcagctatctggaaccagttgcggacggcttccgtaactatggt
cgtggcactgatcgcgtcagaaccgagcagctgcttgttgaccgcgcgcacctgttgact
cttacaccgcccgagatgactgtgcttgttggtggcctgcgtgtactgggcgccaattgg
gacggctctacccacggtgttttcaccaagcgcccgggccagctgaccaacgatttcttt
gtcaacttgctagatatgagcacggcatggaggtctattgacggagaaatctttgagggc
tatgaccgtaagacgggcgagaagaagtggacggctaccagggtcgacctcatctttggc
tcacacgccgagctgcgtgccatcgcggaggtgtatgccagtgccgatgggcaggagaag
tttgtcagggacttcattgctgcttgggacaaagtcatgaacctggatcgctttgatctc
ggcaagcgctga

DBGET integrated database retrieval system