KEGG   Cupriavidus taiwanensis: RALTA_A0276Help
Entry
RALTA_A0276       CDS       T00702                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00010  Glycolysis / Gluconeogenesis
cti00260  Glycine, serine and threonine metabolism
cti00680  Methane metabolism
cti01100  Metabolic pathways
cti01110  Biosynthesis of secondary metabolites
cti01120  Microbial metabolism in diverse environments
cti01130  Biosynthesis of antibiotics
cti01200  Carbon metabolism
cti01230  Biosynthesis of amino acids
Module
cti_M00002  Glycolysis, core module involving three-carbon compounds
cti_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RALTA_A0276 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    RALTA_A0276 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RALTA_A0276 (gpmA)
Enzymes [BR:cti01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RALTA_A0276 (gpmA)
Membrane trafficking [BR:cti04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    RALTA_A0276 (gpmA)
Exosome [BR:cti04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RALTA_A0276 (gpmA)
  Exosomal proteins of melanoma cells
   RALTA_A0276 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAP62946
UniProt: B2AGP7
Position
1:complement(280600..281346)
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNLENRFTGWVDVDLTETGAAQARQAGKLLKEAGMGFDVAYTSVLKR
AIRTLWHVQDEMDLMWIPVRNEWRLNERHYGALAGLNKSETAAKFGDEQVLVWRRSYDTP
PPALEPTDPRASYDDPRYANVPRNEIPLTECLKDTVARVMPLWNESIAPDIQSGKRVVIA
AHGNSIRALVKYLDQISDDDIVGLNIPNGTPLVYELDADLRPLRHYYLGDQEAIAASLAA
VASQGKAR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctcgtcctcatccgccacggcgaatccacgtggaacctcgaaaaccgcttt
accggctgggtcgacgtcgacctgaccgagaccggcgccgcccaggcgcgccaggccggc
aaactgctcaaggaagccggcatgggcttcgacgtggcctacacctcggtgctcaagcgc
gccatccgcacactctggcacgtgcaggatgaaatggacctgatgtggattccggtgcgc
aacgaatggcgcctgaacgagcgccactacggcgccctggccggcctgaacaagtccgag
accgccgccaagttcggcgacgaacaggtgctggtctggcgccgcagctacgacacgccg
ccgccggcgctggagccgaccgatccgcgcgcctcgtacgacgatccgcgctacgccaat
gtgccgcgcaacgagatcccgctgaccgagtgcctgaaggacaccgtggcgcgcgtcatg
ccgctgtggaacgaatccatcgcccccgacatccaatccggcaagcgcgtggtcattgcc
gcccatggcaacagcatccgcgcgctggtgaaatacctggaccagatttcggatgacgac
atcgtcggcctcaacatccccaacggcaccccccttgtctacgagctggacgccgacctg
cgccccctgcgccactactacctgggtgaccaggaagccatcgccgcctcgctggcggcg
gtggccagccagggcaaggcgcgctga

DBGET integrated database retrieval system