KEGG   Cupriavidus taiwanensis: RALTA_A0604Help
Entry
RALTA_A0604       CDS       T00702                                 

Gene name
sciC
Definition
(GenBank) replication/virulence associated protein; DUF879
  KO
K11896  type VI secretion system protein ImpG
Organism
cti  Cupriavidus taiwanensis
Brite
KEGG Orthology (KO) [BR:cti00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cti02044]
    RALTA_A0604 (sciC)
Secretion system [BR:cti02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RALTA_A0604 (sciC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: CAQ68587
UniProt: B3R2V0
Position
1:complement(622817..624697)
Genome map
AA seq 626 aa AA seqDB search
MDPQLLDYYNRELVYMRELAGEFARQHPKVARRLGMQGIEVADPYVERLIEAFCFLSART
EIKLDAEFPRFTQRLLEVIYPNYVAPTPSIAVAQFHPSRGEGDFAHGVEVPRGTEVNAAA
APGEKTACQFRTTQPLILWPLEITEARLTGIPPDVRGPERYVPAHVTVQGALRLRLRCTR
DATFDQLPGLDHLPVYLRGDDLIASQLFELLHSAGVATLIGEPGTMSERPCAVTQDAVSY
VGMGPGEGALPLQWNSFHGHNLLHEYFACPQRFYFFGLNQLAEGLSRIRGKEAEIVVLLS
KPPGDLTSKVDRDQFALYCTPVVNLFPKRTDRIEVTPGRAEFHLVADRQHPLDYEIYAVR
QLSGQKSQHSAGLDFQPLFATLNSDEGNHGRYFSVRRERRLISEQARKYGTRTAYVGTEL
FVSLVDQHEAPYPDALRYLSVESLVTNRDLPNLVPRNGRHDLTPAASIPVDGIGLIRPPS
APRPPYADGEMAWRLIRLLGFNYLSLTDLEHRSGGQGLRDMLRLFVANDDLTHQGQIRSL
IGANVKPVMRRLPGNGPLIYGRGIQCQLTVDEGGFSGISPYLFGVVLEHWLARHVSVNVF
TQTELHSMQRGLVHRWPVRMGGRGAV
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggatccgcaactgctcgattactacaaccgcgagctcgtctacatgcgcgagctggcc
ggtgaattcgccagacagcacccgaaggtcgcaagacggctgggcatgcagggcatcgag
gtggccgacccctacgtggagcgcctgatcgaggcattctgcttcctgtcggcgcggacc
gagatcaagcttgacgcagagttcccgcgcttcacgcagcgtctgctggaggtgatctac
cccaactatgtggcgccgacgccatcgattgcggtcgcgcaattccatcccagccgcggc
gaaggcgattttgcccatggcgtggaggttccgcgcggcacggaggtcaacgcggcggcg
gcgcctggagagaagacggcctgccagttcaggaccacgcagccgttgatactgtggccg
cttgagatcaccgaagcgcggctcaccggcattccgcccgatgtacggggtccggagcgc
tatgtgcccgcccatgtgacagtccagggtgccctgcgcttgcgcctgcgctgtacgcga
gacgccaccttcgatcaactgcccggcctggaccacctgccggtctatctgcgcggcgac
gacctgatcgcctcacaactgttcgaactgttgcacagcgccggtgtggcgacgctgatc
ggcgagcccgggaccatgagcgagcgcccctgcgcggtgacgcaggatgctgtcagttac
gtgggaatgggaccgggcgaaggcgcgctgcccttgcagtggaacagcttccacgggcac
aacctgttgcatgagtacttcgcttgcccgcaacgcttctatttcttcggcctcaaccag
cttgctgagggcctgagccggatccgcggcaaggaagccgagatcgtcgtgctgctgtcg
aagccgcccggggatctgaccagcaaggtcgaccgcgaccaattcgcgctgtattgcaca
ccggtggtcaatctgtttccgaagcgcaccgatcgcatcgaggtcacgccggggcgcgcc
gaatttcatctggttgccgaccgccagcatccgctggactacgaaatctatgccgtcagg
cagctttcgggccagaagtcccagcacagtgccggcctggacttccagccgctctttgcc
acgctgaacagtgacgagggcaatcacggccggtacttttccgtgcggcgcgagcgtcgg
ctgatctctgagcaggcacgcaagtacggcacgcgcacggcatacgtcggcaccgagctg
ttcgtatccctggtggaccagcatgaggcgccttacccggatgccttgcgctatctttcg
gtggagtcgctggtcaccaatcgcgacttgcccaatctggtaccgcgcaatggccggcac
gacctgaccccggcggcttccatccccgtggacggcatcggtctgatccggccgccgtcg
gcaccccggccaccgtacgccgacggcgaaatggcctggcgcctgatacggttgctgggc
ttcaactacttgtccctgaccgacctggagcaccgctcgggcggccaaggcctgcgcgac
atgctgcggctgttcgtagcgaacgacgatctcacgcaccaggggcagattcggagcctg
atcggcgcgaacgtgaagccggtcatgcgtcggctacccggcaatggcccgttgatctat
ggccgcggtatccagtgccagctcaccgtggacgaaggcggcttctccggcatcagcccg
tacctgttcggcgtagtgctggagcattggctggcgcgccacgtctcggtcaatgtcttc
acccaaaccgaactgcactccatgcaacgcggcctggtgcatcgttggcccgtgcgcatg
ggcggccgcggcgccgtgtag

DBGET integrated database retrieval system