KEGG   Cupriavidus taiwanensis: RALTA_A0608
Entry
RALTA_A0608       CDS       T00702                                 

Gene name
sciH
Definition
(GenBank) replication/virulence associated protein; DUF770
  KO
K11901  type VI secretion system protein ImpB
Organism
cti  Cupriavidus taiwanensis
Brite
KEGG Orthology (KO) [BR:cti00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cti02044]
    RALTA_A0608 (sciH)
Secretion system [BR:cti02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RALTA_A0608 (sciH)
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CAQ68591
UniProt: B3R2R0
Position
1:629117..629650
AA seq 177 aa
MSVVNSSQKFIARNRAPRVQIEYDVEVYGSEKRIELPFVMGVLADLSGKPAEPLPAVADR
KFLEIDIDNFDERMKAMKPRVAFAVPNTLSGDGQLMVDMTFESIEDFSPAAVAGKVDALR
QLLEARTQLANLQTYMDGKSGAESLINQLLQDPALLQSLAKAPKPGVGDDEPQSPQS
NT seq 534 nt   +upstreamnt  +downstreamnt
atgtctgttgtgaacagttcgcagaaattcatcgcgcgcaatcgcgcgccgcgcgtgcag
atcgagtacgacgtcgaagtctatggctcggagaaacgtatcgagctgcccttcgtgatg
ggcgtgctggccgacttgtcgggcaagccggccgagccgctgccggcggtggccgatcgc
aagttcctcgagatcgatatcgacaacttcgacgagcgcatgaaggccatgaagccgcgc
gtggcgtttgcggtgcccaatacgctctccggcgacggccaactcatggtcgacatgaca
ttcgagagcatcgaagatttctcccccgcggcggtagccggaaaggtcgatgcactcagg
caactgctcgaagcccgcacccagctcgccaacctgcagacctacatggatggcaagtcg
ggcgccgagtcgctgatcaaccagttgctgcaggatcccgcgctgctgcagtcgcttgcc
aaggcgccaaagcccggggtaggtgacgacgaacctcaatcgccgcagtcctga

DBGET integrated database retrieval system