KEGG   Cupriavidus taiwanensis: RALTA_A0610
Entry
RALTA_A0610       CDS       T00702                                 

Gene name
sciK
Definition
(GenBank) Hcp-related (Hemolysin-coregulated protein) protein; replication/virulence associated protein; DUF796
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
cti  Cupriavidus taiwanensis
Pathway
cti03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cti00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RALTA_A0610 (sciK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cti02044]
    RALTA_A0610 (sciK)
Secretion system [BR:cti02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RALTA_A0610 (sciK)
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: CAQ68593
UniProt: B3R2R2
Position
1:631322..631807
AA seq 161 aa
MAQDIFLKINGIDGESQDASHKNEIEVLAWDWSIEQQSTMHAGSGGGAGKATVSDLSFEH
FIDRASPNLMKYCLTGKHINEAVLVVRKAGGNPLEYLKLTMTDVIVTRVSPKGSVDDEVR
MREQVALSFSRVKQEYVVQNAQGGSGGAVTAGYDIKGNKEA
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcacaggacattttcctgaagatcaacggcatcgatggcgagtcgcaggatgcctcg
cacaagaatgaaatcgaagtgctggcctgggactggagcatcgagcaacagtccaccatg
cacgcgggcagcggcggcggcgccggcaaggccaccgtgtcggacctgtccttcgagcac
ttcatcgatcgcgcttcgcccaacctgatgaagtactgcctgaccggcaagcacatcaac
gaggcggtgctggtggtgcgcaaggcaggcggcaatccgctcgaatacctgaagctcacc
atgaccgacgtcatcgtcaccagggtgagccccaagggctcggtggatgacgaagtgcgc
atgcgcgagcaggtggcgctgtcgttctccagggtcaagcaggagtatgtggtgcagaac
gcccagggcggcagcggcggggcggtgaccgcgggctacgacatcaagggcaacaaggaa
gcctga

DBGET integrated database retrieval system