KEGG   Cupriavidus taiwanensis: RALTA_A0817
Entry
RALTA_A0817       CDS       T00702                                 

Definition
(GenBank) conserved hypothetical protein; putative peroxidase-related enzyme
Organism
cti  Cupriavidus taiwanensis
SSDB
Motif
Pfam: CMD PA26 CecR_C
Other DBs
NCBI-ProteinID: CAQ68789
UniProt: B3R3A8
Position
1:850631..851221
AA seq 196 aa
MSDTAFPISRYAIPPLADLPDDIRARILEVQEKAGFVPNVFLALAHRPDEFRAFFAYHDA
LMLKDGGLTKGEREMIVVATSAANQCLYCVVAHGAILRIYEKKPLVADQVAVNYLKADIP
PRQRAMLDFAMKVCTASHEVGEADFDALRAHGFSDEDAWDIAAITAFFGLSNRMANTIGM
RPNDEFYLMGRVPKAK
NT seq 591 nt   +upstreamnt  +downstreamnt
atgtcagacacggcattcccgatcagccgctacgccatcccgccgctggccgacctcccc
gacgatatccgcgcgcgcatcctggaggtccaggaaaaggccggcttcgttcccaacgtg
ttcctggcgctggcgcaccgtcccgacgagttccgcgccttcttcgcctatcacgatgcg
ctgatgctcaaggacggcggcctgaccaagggcgagcgcgagatgatcgtggtggccacg
tccgccgccaaccagtgcctgtattgcgtggtggcgcatggcgcgatcctgcgcatctac
gagaagaagccgctggtcgccgaccaggtcgcggtgaactacctgaaggccgacatcccg
ccgcgccagcgcgccatgctcgactttgcgatgaaggtctgcaccgcgtcgcatgaagtc
ggggaggccgatttcgatgcgctgcgcgcgcatggcttttccgacgaggatgcctgggat
atcgccgcgatcaccgcgttcttcggcctgtccaaccgcatggccaataccatcggcatg
cgcccgaacgacgagttctacctgatggggcgggtgccgaaggcgaagtag

DBGET integrated database retrieval system