KEGG   Cupriavidus taiwanensis: RALTA_A1289Help
Entry
RALTA_A1289       CDS       T00702                                 

Gene name
folD
Definition
(GenBank) bifunctional: 5,10-methylene-tetrahydrofolate dehydrogenase; 5,10-methylene-tetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00670  One carbon pool by folate
cti01100  Metabolic pathways
cti01120  Microbial metabolism in diverse environments
cti01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cti00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    RALTA_A1289 (folD)
Enzymes [BR:cti01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     RALTA_A1289 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     RALTA_A1289 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH OCD_Mu_crystall AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: CAQ69249
UniProt: B3R4L6
Position
1:complement(1325865..1326716)
Genome map
AA seq 283 aa AA seqDB search
MPAQLIDGNALAKQIRSEAAQRAARLTERGHQPGLAVVLVGEDPASQVYVRNKVKACEDN
GFHSSLDRYPADLSEADLLARIDELNRDPRIHGILVQLPLPKHIDSHKVLEAIAPEKDVD
GFHVANAGALMTGAPLFRPCTPYGCMKMLESIQYPLRGARAVVVGASNIVGKPMAMLLLQ
GGATVTICNSKTRDIGAHTRDADVVVAAVGKRNLITADMVKPGAVVIDVGMNRDDHGKLC
GDVDFAGVREVAGYITPVPGGVGPMTITMLLINTLEAAERAAG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcccaactgatcgacggcaacgcccttgccaagcaaatccgctccgaagccgcc
cagcgcgccgcccgcctgaccgaacgcggccaccagcccgggctggccgtggtcctggtg
ggcgaagacccggccagccaggtctatgtgcgcaacaaggtcaaggcctgcgaggacaac
ggcttccattcgtcgctggaccgctatccggccgacctgtccgaggccgacctgctggcc
cggatcgacgaactcaaccgcgatccccgtatccacggcatcctggtgcagctgccgctg
cccaagcacatcgacagccacaaggtgctggaagcgatcgcgcccgaaaaggacgtcgac
ggcttccatgtcgccaacgccggcgcgctgatgaccggcgccccgctgttccgcccgtgt
acgccctatggctgcatgaagatgctggaatcgatccagtacccgctgcgcggcgcgcgc
gccgtggtggtgggcgcgtccaacatcgtcggcaagccgatggcgatgctgctgctgcag
ggcggcgccaccgtcaccatctgcaacagcaagacccgcgatatcggcgcccacacccgc
gacgccgacgtggtggtggccgcggtcggcaagcgcaacctgatcacggccgacatggtc
aagcccggcgcggtagtgatcgatgtcggcatgaaccgcgacgaccatggcaagctgtgc
ggcgacgtcgacttcgccggcgtgcgcgaagtcgccggctacatcacgccggtgcctggc
ggggtggggccgatgaccatcaccatgctgctgatcaacacgctggaagccgccgagcgc
gccgcgggctga

DBGET integrated database retrieval system