KEGG   Cupriavidus taiwanensis: RALTA_A1294Help
Entry
RALTA_A1294       CDS       T00702                                 

Gene name
pdhB
Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00010  Glycolysis / Gluconeogenesis
cti00020  Citrate cycle (TCA cycle)
cti00620  Pyruvate metabolism
cti01100  Metabolic pathways
cti01110  Biosynthesis of secondary metabolites
cti01120  Microbial metabolism in diverse environments
cti01130  Biosynthesis of antibiotics
cti01200  Carbon metabolism
Module
cti_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RALTA_A1294 (pdhB)
   00020 Citrate cycle (TCA cycle)
    RALTA_A1294 (pdhB)
   00620 Pyruvate metabolism
    RALTA_A1294 (pdhB)
Enzymes [BR:cti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RALTA_A1294 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 HlyD_3 TonB_N FAP CAT
Motif
Other DBs
NCBI-ProteinID: CAQ69254
UniProt: B3R4M1
Position
1:1334341..1336029
Genome map
AA seq 562 aa AA seqDB search
MSQAIEIKVPDIGDYDAVPVIEVHVKPGDSINAEDALVTLESDKATMDVPSPQAGVVKDV
KIKVGDNVAEGSVLVMLEPAGQAAAAPAAAPAAAPAPAPAPAPAAAAPAPAPAPAPAPAP
AAAPAAAGGTIEVKVPDIGDYDAVPVIEVHVKPGDTISAEDAVVTLESDKATMDVPSPQG
GVVKEVKVKVGDNVSEGTLLLILEGAATAAAAAPAAAAAAPAAAASAPAPAPAPAAAPAP
AAAPAAAPAPVGATGKAAHASPSVRKFARELGVDVSRVPGTGPKGRITQEDVQNYVKGVM
TGQAAAPAQAAAAGAGGGELGLLPWPKVDFTRFGEVESKALSRIKKISGANLHRNWVMIP
HVTNHDEADITDLEAFRVQLNKENEKAGVKVTMLAFMIKATVAALKKFPNFNASLDGDNL
VLKKYFNIGFAADTPNGLVVPVIKDADKKGVLEISQEMSELAKLARDGKLKPDQMQGGCF
SISSLGGIGGTYFTPIINAPEVAIMGVCKSYMKPVWDGKQFAPRLTLPLSLSWDHRVIDG
AEAARFNTYFAQLLADFRRILL
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgattgaaatcaaggtgccggatatcggcgactatgacgccgtccccgtc
attgaagtgcatgtgaaacccggcgacagcatcaacgcggaagacgcgctggtgacgctg
gagtccgacaaggccaccatggacgtgccgtcgccgcaggccggcgtggtcaaggacgtc
aagatcaaggttggcgacaacgtggccgaaggctcggtgctggtgatgctggagccggcc
gggcaggccgctgccgcacctgccgccgcacctgcagccgcgcccgcaccggctcccgcg
ccggcacctgccgcagccgctccggcccctgcgcccgctcccgctcccgctcccgctccc
gccgcggcgccggccgccgctggcggcaccatcgaagtcaaggtgcccgatatcggcgac
tacgacgccgttccggtaatcgaagtccacgtcaagccgggcgacaccatcagcgcagaa
gacgcggtggtgacgctggaatcggacaaggccaccatggacgtgccttcgccgcagggc
ggcgtggtcaaggaagtcaaggtcaaggtcggcgacaacgtgtccgaaggcacgctgctg
ctgatcctggaaggcgcggccaccgccgctgctgccgcaccggccgctgccgccgcggca
ccggctgccgctgccagcgcgcccgctccggcgccggcgcctgccgccgcgcccgcgccg
gccgctgcgccggctgccgcgccggcccctgtcggcgcaaccggcaaggccgcccacgcc
agcccctcggtgcgcaagttcgcgcgcgagctgggcgtcgatgtctcgcgcgtgccgggc
accggtcccaagggccgcatcacccaggaagacgtgcagaactatgtcaagggcgtgatg
accggccaggccgccgcgccggcccaggctgccgcggccggcgccggtggtggcgagctc
ggcctgctgccgtggccgaaggtcgatttcacccgcttcggcgaggtcgaaagcaaggcc
ctgtcgcgcatcaagaagatttcgggtgccaacctgcaccgcaactgggtcatgatcccg
cacgtcaccaaccatgacgaagcggacatcaccgacctggaagccttccgcgtgcagctg
aacaaggaaaacgagaaggccggcgtcaaggtgaccatgctggcgttcatgatcaaggcc
acggtcgcggcgctgaagaagttcccgaacttcaatgcttcgctcgacggcgacaacctg
gtgctgaagaagtacttcaacatcggcttcgccgccgacaccccgaacggcctggttgtg
ccggtgatcaaggacgccgacaagaagggcgtgctcgagatcagccaggaaatgagcgag
ctggccaagctggcgcgcgacggcaagctcaagcccgaccagatgcagggcggctgcttc
tcgatttcgtcgctgggcggcatcggcggcacgtacttcacgccgatcatcaatgcgccc
gaagtggccattatgggcgtgtgcaagtcgtacatgaagccggtgtgggacggcaagcag
ttcgcgccgcgcctgacgctgccgctgtcgctgtcgtgggaccaccgcgtcatcgacggt
gccgaggcggcgcgcttcaacacgtacttcgcgcaactgctggcggacttccgccgcatc
ctgctctaa

DBGET integrated database retrieval system