KEGG   Cupriavidus taiwanensis: RALTA_A1351Help
Entry
RALTA_A1351       CDS       T00702                                 

Gene name
phaA
Definition
(GenBank) Acetyl-CoA acetyltransferase (beta-ketothiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00071  Fatty acid degradation
cti00072  Synthesis and degradation of ketone bodies
cti00280  Valine, leucine and isoleucine degradation
cti00310  Lysine degradation
cti00362  Benzoate degradation
cti00380  Tryptophan metabolism
cti00620  Pyruvate metabolism
cti00630  Glyoxylate and dicarboxylate metabolism
cti00640  Propanoate metabolism
cti00650  Butanoate metabolism
cti00900  Terpenoid backbone biosynthesis
cti01100  Metabolic pathways
cti01110  Biosynthesis of secondary metabolites
cti01120  Microbial metabolism in diverse environments
cti01130  Biosynthesis of antibiotics
cti01200  Carbon metabolism
cti01212  Fatty acid metabolism
cti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RALTA_A1351 (phaA)
   00630 Glyoxylate and dicarboxylate metabolism
    RALTA_A1351 (phaA)
   00640 Propanoate metabolism
    RALTA_A1351 (phaA)
   00650 Butanoate metabolism
    RALTA_A1351 (phaA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RALTA_A1351 (phaA)
   00072 Synthesis and degradation of ketone bodies
    RALTA_A1351 (phaA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RALTA_A1351 (phaA)
   00310 Lysine degradation
    RALTA_A1351 (phaA)
   00380 Tryptophan metabolism
    RALTA_A1351 (phaA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RALTA_A1351 (phaA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RALTA_A1351 (phaA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RALTA_A1351 (phaA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cti04147]
    RALTA_A1351 (phaA)
Enzymes [BR:cti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RALTA_A1351 (phaA)
Exosome [BR:cti04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RALTA_A1351 (phaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CAQ69308
UniProt: B3R4S6
Position
1:1396647..1397828
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAARTAVGKFGGSLAKIPAPELGAIVIKAALERAGIQPEQVSEVIMGQVLTAG
SGQNPARQASIKAGLPAMVPAMTINKVCGSGLKAVMLAANAIMSGDAEIVVAGGQENMSA
APHVLPGSRDGFRMGDTKLVDTMIVDGLWDVYNQYHMGITAENVAKEYGITREAQDEFAV
GSQNKAEAAQKAGKFDEEIVPVLIPQRKGDPVAFKTDEFVRHGATLDSMAGLKPAFDKAG
SVTAANASGLNDGAAAVVVMSAAKAKELGLTPLATIKSYANAGVDPKVMGMGPVPASKRA
LSRAGWTPQDLDLMEINEAFAAQALAVHQQMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMKRRDAKKGLASLCIGGGMGVALAVERN
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgttgtcatcgtatccgcggcccgtaccgcggttggcaaatttggcggctcg
ctggcgaagattccggcgccggaactgggtgcgatcgtgatcaaggccgcgctggagcgt
gccgggatccagccggagcaggtcagcgaagtgatcatgggccaggtgctgaccgccggc
tcgggccagaacccggcgcgccaggcttcgatcaaggccggcctgccggcaatggtgccg
gcgatgaccatcaacaaggtatgcggctcgggcctgaaggctgtgatgctggccgccaac
gccatcatgtccggcgacgccgagatcgtggtcgccggcggccaggaaaacatgagcgcc
gcgccgcacgtgctgccgggctcgcgcgacggcttccgcatgggcgacaccaagctggtc
gacaccatgatcgtcgacggcctgtgggacgtgtacaaccagtaccacatgggcatcacc
gccgagaacgtggccaaggaatacggcatcacgcgcgaggcccaggatgaattcgcggtg
ggctcgcagaacaaggccgaagccgcgcagaaggccggcaagttcgatgaagaaatcgtg
ccggtgctgatcccgcagcgcaagggcgacccggtggcgttcaagaccgacgaattcgtc
cgtcacggcgccacgctggacagcatggccggcctcaagcccgccttcgacaaggccggc
tcggtgaccgcggccaacgcttcgggcctgaacgacggcgccgccgcggtggtggtgatg
tccgcggccaaggccaaggaactgggcctgaccccgctcgccaccatcaagagctacgcc
aacgccggcgtggacccgaaggtgatgggcatgggcccggtgccggcgtccaagcgcgcg
ctgtcgcgcgccggctggaccccgcaggacctggacctgatggagatcaacgaagccttc
gccgcgcaggcgctggcggtgcaccagcagatgggctgggatacctccaaggtcaatgtc
aacggcggcgccatcgccatcggccatccgatcggtgcgtcgggctgccgtatcctggtg
acgctgctgcacgaaatgaagcgccgcgatgccaaaaagggcctggcgtcgctgtgcatc
ggcggtggcatgggcgtggcgctggcggtcgagcgcaattaa

DBGET integrated database retrieval system