KEGG   Cupriavidus taiwanensis: RALTA_A1685Help
Entry
RALTA_A1685       CDS       T00702                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00900  Terpenoid backbone biosynthesis
cti01100  Metabolic pathways
cti01110  Biosynthesis of secondary metabolites
cti01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RALTA_A1685 (dxr)
Enzymes [BR:cti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     RALTA_A1685 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh DapB_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: CAQ69628
UniProt: B3R2B1
Position
1:complement(1775209..1776390)
Genome map
AA seq 393 aa AA seqDB search
MHRITILGATGSIGESTLDVIRRHPGRYAAHALSAHRQVRKLADQCIEFRPARAVVGTAE
AARELETLLRDASVATEVSYGEAALESIAADAQTDAVMAAIVGAAGLRPTLAAARAGKRV
LLANKEALVMSGRIFMDAVREHGATLLPIDSEHNAIFQCLPADDPRYGRGVAKVLLTASG
GPFRTRDPATLHDISPDQACAHPNWVMGRKISVDSATMMNKGLEVIEAHWLFGAPAERIE
VLIHPQSIVHSMVAYTDGSVLAQLGNPDMRTPIAYGLAYPERIDAGVTPLDLTLAGGLHF
EKPDLARFPCLGLAFDALRAAGVAPAVLNAANEVGVEAFLAGQVRFTDIAGIVRQVLEEA
PSGPADTLEAVLAADALAREAARAGVTARAAAR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcatcaccatcctgggcgccaccggctccatcggagaaagcacgctcgacgtg
atccggcgccatcccggccgttacgcggcgcatgcgctcagcgcccatcggcaggtgcgc
aagctggccgaccagtgcatcgagttccgcccggcgcgcgccgtggtcgggacggccgag
gcggcgcgtgaactggaaacgctgctgcgcgatgccagcgtggccaccgaggtcagctac
ggcgaggccgcgctggaatccatcgccgccgacgcgcagaccgatgcggtgatggccgcc
atcgtcggcgcggcgggcctgcgcccgacgctggcggcggcgcgcgcgggcaagcgcgtg
ctgctggccaacaaggaagccctggtcatgtccgggcgcatcttcatggacgcggtgcgc
gagcacggcgctacgctgctgccgatcgacagcgagcacaacgccatcttccagtgcctg
cccgccgacgacccgcgctacggccgcggcgtggccaaggtgctgctgaccgcgtcgggc
gggccgttccgtacccgcgatccggccacgctgcacgatatctcgcctgaccaggcctgc
gcccatcccaactgggtcatgggccgcaagatctcggtcgactcggccaccatgatgaac
aaaggcctcgaggtgatcgaggcgcactggctgttcggcgccccggccgagcgcatcgag
gtgctgatccacccgcagagcatcgtgcattcgatggtggcctacaccgacggctcggtg
ctggcgcagctgggcaaccccgacatgcgcaccccaatcgcctatggcctggcctatccg
gaacggatcgacgcgggcgtgacgccgctcgacctgaccctcgccggcggcctgcatttc
gaaaagccggacctggcgcggttcccgtgcctggggctggccttcgacgcgctgcgggcg
gcgggggtggcacccgcggtgctcaatgccgccaatgaagtgggggtagaggcattcctg
gcgggccaggtgcgctttaccgatatcgccggcatcgtgcgtcaggtgctggaggaagca
ccgagcggacccgccgacacgctcgaggccgtgctcgccgccgacgcgctggcgcgcgag
gcggccagggccggcgtcaccgcgcgggccgcggcccgctga

DBGET integrated database retrieval system