KEGG   Cupriavidus taiwanensis: RALTA_A1809Help
Entry
RALTA_A1809       CDS       T00702                                 

Gene name
thrC
Definition
(GenBank) THREONINE SYNTHASE
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00260  Glycine, serine and threonine metabolism
cti00750  Vitamin B6 metabolism
cti01100  Metabolic pathways
cti01110  Biosynthesis of secondary metabolites
cti01120  Microbial metabolism in diverse environments
cti01230  Biosynthesis of amino acids
Module
cti_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RALTA_A1809 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RALTA_A1809 (thrC)
Enzymes [BR:cti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RALTA_A1809 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: CAQ69751
UniProt: B3R2N3
Position
1:complement(1907257..1908702)
Genome map
AA seq 481 aa AA seqDB search
MKYQSTRGHEMPQSFSEILLGGLAPDGGLYLPAQYPQVTADELEAWRKLPYADLAYEILR
KFCDDIPAEDLRALTRKTYTPEVYCNAREGDNTADITPLRTLGEEGGTKLQLLSLSNGPT
LAFKDMAMQLLGNLFEYALARAGQELNILGATSGDTGSAAEYAMRGKRGIRVFMLSPHRK
MSAFQTAQMFSLQDPNIFNIAIDGVFDDAQDIVKAVSNDHAFKARQKIGTVNSINWARVV
AQVVYYFKGWLLATDGPGQKVSFCVPSGNFGNVCAGHIARMMGLPIDKLVVATNENDVLD
EFFRTGAYRVRKSAETYHTSSPSMDISKASNFERFVFDLLGQDAGKLAALFRDVEEKGGF
DLSGTPEFDRIRQFGFVSGRSTHQDRLATIRDLSSRYGITIDTHTADGIKVAREHLRAGV
PMVVLETALPAKFADTIREALGHEPERPAKFEGIESLPQRFEVMPADAAQVKAYIARHTG
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaataccagtcgacccgcggccacgagatgccgcaatcgttttccgagatcttgctg
ggcggcctggcgccggacggcggcctgtacctgcccgcgcagtatccgcaggtcaccgcc
gacgagctggaagcgtggcgcaagctgccgtatgccgacctggcctacgagatcctgcgc
aagttctgcgacgacattccggccgaggacctgcgcgcgctgacgcgcaagacctatacg
ccggaggtgtactgcaacgcgcgcgagggcgacaacaccgccgacatcacgccgctgcgc
acgctgggcgaggagggtggcacgaagttgcagctgctgagcctgtccaatggcccgacg
ctggcgttcaaggacatggcgatgcagctgctcggcaacctgttcgagtacgcgctcgcc
cgtgccggccaggagctgaacatcctcggcgccacctccggcgacaccggcagcgctgcc
gaatacgcgatgcgcggcaagcgcggcatccgcgtgttcatgctgagcccgcaccgcaag
atgagcgcgttccagaccgcgcagatgttcagcctgcaggacccgaacatcttcaacatc
gccatcgacggcgtgtttgacgacgcccaggacatcgtcaaggcggtctcgaacgaccac
gccttcaaggcgcgccagaagatcggcacggtcaactcgatcaactgggcacgcgtggtg
gcccaggtggtgtactacttcaagggctggctgctggcaaccgacggtcccggccagaag
gtctcgttctgcgtgccgtcgggcaacttcggcaacgtctgcgccggccatatcgcgcgc
atgatgggcctgccgatcgacaagctggtggtggccaccaacgagaacgacgtgctcgac
gagttcttccgcaccggtgcctaccgcgtgcgcaagtcggccgagacttaccacacctcc
agccccagcatggacatctccaaggcctcgaacttcgagcgcttcgtgttcgacctgctg
ggccaggacgccggcaagctggcggcactgttccgcgacgtggaggaaaagggcggcttc
gacctgtcgggcacgccggaattcgaccgcatccgccagttcggctttgtctcgggccgc
agtacgcaccaggaccggctggcgaccatccgcgacctgtcgtcgcgctatggcatcacc
atcgatacccataccgccgacggcatcaaggtggcgcgcgagcacctccgcgccggcgtg
cctatggtggtgctggaaaccgcgctgcccgccaagttcgccgacaccatccgcgaggcg
ctgggccacgagccggagcgcccggcgaagttcgagggcatcgaaagcctgccgcagcgc
ttcgaggtcatgccggccgacgccgcgcaggtcaaggcctatatcgcccgccacaccggc
ctgtaa

DBGET integrated database retrieval system